NVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGFKMNYQVNGYPNMFITREEAIRH
The query sequence (length=523) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
7egq:X |
524 |
522 |
0.9981 |
0.9962 |
1.0000 |
0.0 |
5c8s:B, 5c8s:D, 5c8t:B, 5c8t:D, 5c8u:B, 5c8u:D, 7diy:B, 7egq:K, 7eiz:K, 9fw2:B, 9fz4:B, 9fzk:B, 7mc5:A, 7mc6:A, 7n0b:B, 7n0c:B, 7n0d:B, 7n0d:D, 7n0d:F, 7n0d:H, 5nfy:A, 5nfy:B, 5nfy:C, 5nfy:D |
2 |
5slp:D |
465 |
501 |
0.8891 |
1.0000 |
0.9281 |
0.0 |
7qgi:D, 7qif:D, 7r2v:A, 5skw:D, 5skx:D, 5sky:D, 5skz:D, 5sl0:D, 5sl1:D, 5sl2:D, 5sl3:D, 5sl4:D, 5sl5:D, 5sl6:D, 5sl7:D, 5sl8:D, 5sl9:D, 5sla:D, 5slb:D, 5slc:D, 5sld:D, 5sle:D, 5slf:D, 5slg:D, 5slh:D, 5sli:D, 5slj:D, 5slk:D, 5sll:D, 5slm:D, 5sln:D, 5slo:D, 5slq:D, 5slr:D, 5sls:D, 5slt:D, 5slu:D, 5slv:D, 5slw:D, 5slx:D, 5sly:D, 5slz:D, 5sm0:D, 5sm1:D, 5sm2:D, 5sm3:D, 5sm4:D, 5sm5:D, 5sm6:D, 5sm7:D, 5sm8:D, 5sm9:D, 5sma:D, 5smb:D, 5smc:D, 5smd:D, 5sme:D, 5smf:D, 5smg:D, 5smh:D, 5smi:D, 5smk:D |
3 |
7r2v:B |
439 |
500 |
0.8356 |
0.9954 |
0.8740 |
0.0 |
|
4 |
9feh:A |
264 |
231 |
0.3576 |
0.7083 |
0.8095 |
3.50e-128 |
8bwu:A, 8e1f:D, 8frj:A, 8frk:A, 2qb0:C, 7tw7:A, 7tw8:A, 7tw9:A |
5 |
2j68:A |
680 |
46 |
0.0344 |
0.0265 |
0.3913 |
0.33 |
2w6d:A, 2w6d:B |
6 |
5egj:A |
167 |
50 |
0.0421 |
0.1317 |
0.4400 |
4.5 |
5egl:A, 5egl:B, 5egl:C |
7 |
6wkz:B |
296 |
82 |
0.0402 |
0.0709 |
0.2561 |
5.2 |
6wkz:A, 6wl6:A, 6wl6:B |
8 |
6mpx:A |
673 |
69 |
0.0363 |
0.0282 |
0.2754 |
5.7 |
1t61:C, 1t61:F |
9 |
4f21:E |
206 |
144 |
0.0746 |
0.1893 |
0.2708 |
6.2 |
|
10 |
5y5n:A |
288 |
33 |
0.0268 |
0.0486 |
0.4242 |
8.0 |
7bot:A, 5fyq:B, 4rmi:A, 8tgp:A, 4y6l:A, 4y6l:B, 4y6o:A, 4y6o:B, 4y6q:D |
11 |
3i39:X |
635 |
54 |
0.0344 |
0.0283 |
0.3333 |
8.0 |
3b51:X, 3b52:X, 3b53:X, 7err:A, 5fle:X, 8omx:X, 8omy:X, 8on0:X, 8on1:X, 8on2:X, 8on3:X, 1su6:A, 1su7:A, 1su8:A, 1suf:A, 4udx:X, 4udy:X, 8x9d:A, 8x9e:A, 8x9f:A, 8x9g:A, 8x9h:A, 7xdm:A, 7xdn:A, 7xdp:A, 2yiv:X, 7zx3:X, 7zx5:X, 7zx6:X, 7zxc:X, 7zxj:X, 7zxl:X, 7zxx:X, 7zy1:X |