NVSVAAYLAVLLGTFIPVVFLLTLYIQSESRKAAET
The query sequence (length=36) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8wb4:M | 36 | 36 | 1.0000 | 1.0000 | 1.0000 | 2.28e-19 | 8wb4:m |
2 | 8xlp:m | 38 | 36 | 0.8889 | 0.8421 | 0.8889 | 2.03e-17 | |
3 | 7y5e:ML | 42 | 36 | 0.6944 | 0.5952 | 0.6944 | 3.26e-12 | 7y5e:m6, 7y7a:M9, 7y7a:ME, 7y7a:mO, 7y7a:mZ, 7y7a:Mm |
4 | 8j5k:M | 41 | 35 | 0.5833 | 0.5122 | 0.6000 | 2.17e-10 | 8j5k:m |
5 | 4yuu:m2 | 40 | 33 | 0.5556 | 0.5000 | 0.6061 | 5.24e-08 | 4yuu:m1, 4yuu:M2 |
6 | 8wql:MD | 36 | 35 | 0.4167 | 0.4167 | 0.4286 | 3.35e-04 | 8wql:ME, 8wql:M1, 8wql:m1, 8wql:mD, 8wql:mE |
7 | 3a0b:M | 36 | 29 | 0.3056 | 0.3056 | 0.3793 | 0.020 | 3a0b:m, 3a0h:M, 3a0h:m, 5b66:M, 7d1u:M, 7d1u:m, 7dxh:m, 8f4f:m, 6jln:M, 6jlo:M, 6jlp:M, 5mx2:m, 1s5l:M, 1s5l:m, 5tis:M, 5v2c:M |
8 | 7ymi:M | 31 | 24 | 0.3611 | 0.4194 | 0.5417 | 0.049 | 7ymi:m, 7ymm:1M, 7ymm:2M, 7ymm:3M, 7ymm:4M |
9 | 5xnl:M | 33 | 30 | 0.2778 | 0.3030 | 0.3333 | 1.1 | 7oui:M, 7oui:m, 5xnl:m, 5xnm:M, 5xnm:m |
10 | 8tow:M | 31 | 23 | 0.2778 | 0.3226 | 0.4348 | 1.2 | 8tow:m |
11 | 8bd3:m | 57 | 30 | 0.3056 | 0.1930 | 0.3667 | 7.6 | |
12 | 5v9x:A | 772 | 31 | 0.3333 | 0.0155 | 0.3871 | 8.7 |