BioLiP

>protein
NVSTVYVPTETSDTSLTVKDGFQWRKYGQKVTRDNPSPRAYFRCSFAPSCPVKKKVQRSAEDPSLLVATYEGTHNHLG

The query sequence (length=78) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7z0r:A	81	78	0.9872	0.9506	0.9872	9.84e-55	7z0r:B, 7z0u:A
2	2ayd:A	76	59	0.4487	0.4605	0.5932	1.23e-22
3	1wj2:A	71	66	0.4615	0.5070	0.5455	4.73e-22	2lex:A
4	8iex:A	88	73	0.4103	0.3636	0.4384	1.10e-20
5	8k31:B	79	70	0.3974	0.3924	0.4429	1.06e-19
6	6j4g:B	58	57	0.3718	0.5000	0.5088	1.32e-16
7	6j4f:B	63	60	0.3718	0.4603	0.4833	1.30e-15	6j4f:F
8	5w3x:D	73	59	0.3462	0.3699	0.4576	1.56e-12	7p8k:B, 5w3x:B
9	7d11:A	79	60	0.3205	0.3165	0.4167	2.76e-12	6j4e:B
10	6ir8:A	69	60	0.3205	0.3623	0.4167	3.50e-12
11	5w1j:A	584	32	0.1282	0.0171	0.3125	2.5	5w1j:B, 5w1l:A, 5w1l:B
12	4rdv:B	451	30	0.1538	0.0266	0.4000	3.3	3mdu:A, 3mdw:A, 3mdw:B, 3mdw:C, 3mdw:D, 4rdv:A, 4rdv:C, 4rdv:D, 4rdw:A, 4rzb:A, 4rzb:B
13	2ysm:A	111	33	0.1538	0.1081	0.3636	5.4
14	3o3u:N	580	28	0.1154	0.0155	0.3214	6.0	2l7u:A, 7lml:A, 7lml:B, 7lmw:A, 7lmw:B, 2mov:A, 4oi7:A, 4oi8:A, 4oi8:B, 6xq1:A, 6xq1:B, 6xq3:A, 6xq3:B, 6xq5:A, 6xq5:B, 6xq6:A, 6xq6:B, 6xq7:A, 6xq7:B, 6xq8:A, 6xq8:B, 6xq9:A, 6xq9:B
15	8tqm:A	843	29	0.1410	0.0130	0.3793	7.2
16	5cxy:A	292	33	0.1538	0.0411	0.3636	7.9	5bo6:A, 5bo6:B, 5bo7:A, 5bo7:B, 5bo9:A, 5bo9:B, 5cxy:B

[Back]