NVQFSNQDGALGEPANYTQFQHVLTESELQISDAEGKKGNKEYFALDGNFTGIVNQYFYVDKKSEALVFKMKNDHLRNEV
RVHKNFRTDLPNKLYTLSAEVEIIDPVASMKNSNSKQNEITFLQVANKGLDNQGTHNVPHPLLRVVWKEDANSVKGHFWA
MVKNNAVICKGSFGKKNKDKEMCKADVAYKKYDLGKAPLNKATAFDITVGNKQLIIDVDGKRLVEHDIDYWRHLLSYFKA
GVANQFTNGMSEAHFNKLEYKALETK
The query sequence (length=266) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7c8f:A | 266 | 266 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 7c8f:B |
2 | 7w16:A | 264 | 255 | 0.4549 | 0.4583 | 0.4745 | 9.62e-67 | |
3 | 7w18:A | 212 | 235 | 0.2293 | 0.2877 | 0.2596 | 1.60e-11 | 7w13:A |
4 | 7ncz:A | 227 | 241 | 0.2105 | 0.2467 | 0.2324 | 0.10 | 7nm6:A, 7npp:A, 7ny3:A, 7o6h:A, 7oof:A, 7ory:A, 7p25:A, 7p90:A, 7pbf:A |
5 | 3rf7:A | 362 | 187 | 0.1504 | 0.1105 | 0.2139 | 0.98 | |
6 | 3wnk:A | 712 | 118 | 0.1053 | 0.0393 | 0.2373 | 1.2 | 3wnl:A, 3wnm:A, 3wnn:A, 3wnn:B, 3wno:A, 3wno:B, 3wnp:A, 3wnp:B |
7 | 4hrg:A | 114 | 36 | 0.0526 | 0.1228 | 0.3889 | 2.3 | 1bt6:A, 1bt6:B, 4drw:A, 4drw:B, 4drw:C, 4drw:D, 4ftg:A, 4ftg:B, 4hre:E, 4hre:F, 4hre:I, 4hre:J, 4hrg:B, 4hrh:A, 4hrh:B |
8 | 8cuy:A | 1016 | 27 | 0.0451 | 0.0118 | 0.4444 | 3.1 | |
9 | 6c5c:A | 385 | 76 | 0.0865 | 0.0597 | 0.3026 | 4.9 | 6c5c:B |
10 | 8twe:B | 423 | 42 | 0.0489 | 0.0307 | 0.3095 | 9.5 |