NVEKFEGAELHVHVTGSISAALVPWWIHWLREFQPELVVNVSVTPAASRFLAVRALRHLANGKVWVDSWDDPDVPPEVNS
The query sequence (length=176) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
6jdd:A |
176 |
176 |
1.0000 |
1.0000 |
1.0000 |
3.37e-128 |
|
2 |
7cfu:F |
175 |
133 |
0.1875 |
0.1886 |
0.2481 |
0.034 |
7cfu:H, 7cfu:S, 7cfu:T, 7cfu:P, 7cfu:A, 7cfu:B, 7cfu:C, 7cfu:D, 7cfu:E, 7cfu:G, 7cfu:I, 7cfu:J, 7cfu:K, 7cfu:L, 7cfu:M, 7cfu:N, 7cfu:O, 7cfu:Q, 7cfu:R, 7cfu:U, 7cfu:V, 7cfu:W, 7cfu:X |
3 |
6jls:A |
162 |
118 |
0.1761 |
0.1914 |
0.2627 |
0.094 |
|
4 |
5zue:A |
309 |
69 |
0.1307 |
0.0744 |
0.3333 |
0.33 |
4kwe:A, 4kwe:B, 4kwe:C, 2q1y:A, 1rlu:A, 1rq7:A, 5v68:B, 5v68:E, 6y1u:A, 6y1u:B, 6y1v:A, 6y1v:B, 6ym1:A, 6ym9:A |
5 |
6tgv:C |
389 |
157 |
0.2330 |
0.1054 |
0.2611 |
0.41 |
8ow5:A, 8ow5:B, 8ow5:C, 8ow5:D, 8owb:A, 8owb:B, 8owb:C, 8owb:D, 8owp:A, 8owp:B, 8owp:C, 8owp:D, 8owq:A, 8owq:B, 8owq:C, 8owq:D, 8owr:A, 8owr:C, 8owr:D, 4qji:A, 4qji:B, 6tgv:A, 6tgv:B, 6tgv:D, 6th2:A, 6th2:C, 6thc:A, 6thc:B, 6thc:C, 6thc:D |
6 |
6ax9:A |
340 |
23 |
0.0682 |
0.0353 |
0.5217 |
0.55 |
6axm:A, 6axn:A, 6axu:A, 3kb9:A, 7kj8:A, 7kj9:A, 7kjd:A, 7kje:A, 7kjf:A, 7kjg:A, 3lg5:A, 4ltz:A, 4luu:A, 4lxw:A, 4lz0:A, 4lz3:A, 4lzc:A, 6ofv:A, 8su1:A, 8su2:A, 8su3:A, 8su4:A, 8su5:A, 8v3k:A |
7 |
4csf:K |
251 |
88 |
0.1307 |
0.0916 |
0.2614 |
0.99 |
4csf:A, 4csf:B, 4csf:F, 4csf:C, 4csf:D, 4csf:E, 4csf:G, 4csf:H, 4csf:L, 4csf:I, 4csf:J, 4csf:M, 4csf:N, 4csf:R, 4csf:O, 4csf:P, 4csf:Q, 4csf:S, 4csf:T, 4csf:X, 4csf:U, 4csf:V, 4csf:W |
8 |
4eh1:A |
237 |
49 |
0.0852 |
0.0633 |
0.3061 |
1.4 |
4eh1:B |
9 |
3ikh:A |
286 |
81 |
0.1136 |
0.0699 |
0.2469 |
2.4 |
3i3y:D, 3ikh:B, 3ikh:C, 3ikh:D |
10 |
6rtd:B |
466 |
74 |
0.1250 |
0.0472 |
0.2973 |
2.6 |
6rtd:A, 6rte:A, 6rte:B |
11 |
5o6m:D |
264 |
50 |
0.0852 |
0.0568 |
0.3000 |
4.1 |
5lc9:B, 5lc9:C, 5lc9:D, 5lcd:A, 5lcd:B, 5lcd:C, 5lcd:D, 5ld1:A, 5ld1:D, 5ld1:B, 5ld1:C, 5ldb:A, 5ldb:B, 5ldb:C, 5ldb:D, 5maq:A, 5maq:B, 5maq:C, 5maq:D, 5o6k:A, 5o6k:B, 5o6k:C, 5o6k:D, 5o6m:A, 5o6m:B, 5o6m:C |