NVEGVKKTILHGGTGELPNFITGSRVIFHFRTMKCDEERTVIDDSRQVGQPMHIIIGNMFKLEVWEILLTSMRVHEVAEF
WCDTIHTGVYPILSRSLRQMAQGKDPTEWHVHTCGLANMFAYHTLGYEDLDELQKEPQPLVFVIELLQVDAP
The query sequence (length=152) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5u9j:A | 152 | 152 | 1.0000 | 1.0000 | 1.0000 | 6.20e-114 | 5u9i:A, 5u9j:B, 5v35:A |
2 | 4lax:A | 237 | 81 | 0.1711 | 0.1097 | 0.3210 | 0.017 | 4drj:A, 4lay:A, 6rcy:A, 4tw8:A, 4tw8:B |
3 | 3pa7:A | 124 | 82 | 0.1645 | 0.2016 | 0.3049 | 0.024 | 3ihz:A, 3ihz:B, 4itz:A, 4itz:B, 4j4o:A, 4mgv:A |
4 | 6mke:A | 117 | 75 | 0.1382 | 0.1795 | 0.2800 | 0.24 | 6mke:B, 6mke:C, 6mke:D |
5 | 6tlx:A | 112 | 71 | 0.1382 | 0.1875 | 0.2958 | 3.7 | |
6 | 6auf:B | 273 | 35 | 0.0724 | 0.0403 | 0.3143 | 6.1 |