NVDEFLFISNNFKQYKEFIDMDTAKHYFECRNIEGLNHILDSYKDSKSTKEKNLFALVKVLLATLTEEDCLTERTYLSNY
LINIETWSHYETVLFNNCMFIFESCFIEMVFSKVILNLDKYNTLRYYGNESIRMFVNMLILFIQRQEYDKASEILAKIED
YQLNDDCLYERCCVSFFDGIIGLINGKEGAEQKCVQILEIFQLLNCKTIHHMFQTYLEAIKHKLSLE
The query sequence (length=227) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6dql:A | 227 | 227 | 1.0000 | 1.0000 | 1.0000 | 3.24e-167 | |
2 | 6w1a:A | 274 | 226 | 0.2731 | 0.2263 | 0.2743 | 2.30e-10 | 6w1a:B, 4yv9:A, 4yv9:B, 4yv9:C, 4yv9:D |
3 | 6w1f:A | 280 | 225 | 0.2467 | 0.2000 | 0.2489 | 0.004 | 7ji0:A, 7ji0:B, 6w1f:B |
4 | 4ryk:A | 295 | 237 | 0.1850 | 0.1424 | 0.1772 | 0.10 | |
5 | 6hqv:A | 1555 | 47 | 0.0705 | 0.0103 | 0.3404 | 0.27 | 6hqv:B |
6 | 6rm3:LJ0 | 168 | 57 | 0.0925 | 0.1250 | 0.3684 | 1.1 | |
7 | 7r49:H | 77 | 19 | 0.0396 | 0.1169 | 0.4737 | 3.7 | |
8 | 2nzy:C | 351 | 46 | 0.0749 | 0.0484 | 0.3696 | 4.6 | 2nzx:A, 2nzx:B, 2nzx:C, 2nzy:A, 2nzy:B, 5zoi:A, 5zoi:B |
9 | 7l7b:C | 1166 | 78 | 0.0969 | 0.0189 | 0.2821 | 4.6 | |
10 | 8y6i:A | 646 | 108 | 0.1366 | 0.0480 | 0.2870 | 5.1 | |
11 | 7b1s:D | 593 | 34 | 0.0573 | 0.0219 | 0.3824 | 7.6 | 7b1s:A, 7b2c:A, 7b2c:D |