NVCPPGLFSNPQCCATQVLGLIGLDCKVPSQNVYDGTDFRNVCAKTGAQPLCCVAPVAGQALLCQTAVGA
The query sequence (length=70) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 2fz6:A | 72 | 68 | 0.9714 | 0.9444 | 1.0000 | 4.84e-44 | 2gvm:B |
| 2 | 2b97:A | 70 | 68 | 0.6429 | 0.6429 | 0.6618 | 1.53e-25 | 3qqt:A, 3qqt:B, 1r2m:A |
| 3 | 6u3e:A | 397 | 34 | 0.1429 | 0.0252 | 0.2941 | 3.9 | 6u3e:B, 6u3g:A, 6u3g:B |
| 4 | 6bbp:A | 520 | 34 | 0.1429 | 0.0192 | 0.2941 | 3.9 | 2a5d:A, 2a5f:A, 2a5g:A, 6bbq:A, 1e0s:A, 1fgy:A, 1fhw:A, 1fhw:B, 1fhx:A, 1fhx:B, 4fme:C, 4fme:F, 2j5x:A, 2j5x:B, 4kax:A, 4kax:B, 3n5c:A, 3n5c:B, 3pcr:B, 2r09:A, 2r09:B, 2r0d:A, 2r0d:B, 3vhx:A, 3vhx:C, 3vhx:E, 3vhx:G, 2w83:A, 2w83:B, 2w83:E, 7xrd:A, 7xrd:B, 7xrd:C, 7xrd:D |
| 5 | 6p29:A | 134 | 31 | 0.1571 | 0.0821 | 0.3548 | 6.1 | 6p29:B |
| 6 | 5l4g:L | 389 | 28 | 0.1429 | 0.0257 | 0.3571 | 8.6 | 5gjq:L, 5gjr:L, 5gjr:z, 5m32:f, 6msb:E, 6msd:E, 6mse:E, 6msg:E, 6msh:E, 6msj:E, 7qxn:E, 7qxp:E, 7qxu:E, 7qxw:E, 7qxx:E, 7qy7:E, 7qya:E, 5t0c:AE, 5t0c:BE, 5t0g:E, 5t0h:E, 5t0i:E, 5t0j:E, 5vfp:E, 5vfr:E, 5vfs:E, 7w37:E, 7w38:E, 7w39:E, 7w3a:E, 7w3b:E, 7w3c:E, 7w3f:E, 7w3i:E, 7w3j:E, 7w3k:E, 7w3m:E, 6wjd:E, 6wjn:E |
| 7 | 1id8:A | 137 | 64 | 0.2714 | 0.1387 | 0.2969 | 9.5 |
umich.edu