NTVTSAVKTQYVEIESVDGFYFNTEDKFDTAQIKKAVLHTVYNEGYTGDDGVAVVLREYESEPVDITAELTFGDATPANT
YKAVENKFDYEIPVYYNNATLKDAEGNDATVTVYIGLKGDTDLNNIVDGRDATATLTYYAATSTDGKDATTVALSPSTLV
GGNPESVYDDFSAFLSDVKVDAGKELTRFAKKAERLIDGRDASSILTFYTKSSVDQYKDMAANEPNKLWDIVTGDA
The query sequence (length=236) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4iu2:B | 238 | 236 | 1.0000 | 0.9916 | 1.0000 | 5.51e-171 | 4iu3:B, 4wkz:A |
2 | 8ajy:B | 84 | 95 | 0.1568 | 0.4405 | 0.3895 | 1.11e-06 | 8ajy:D |
3 | 8ajy:B | 84 | 29 | 0.0593 | 0.1667 | 0.4828 | 0.33 | 8ajy:D |
4 | 8ajy:B | 84 | 28 | 0.0466 | 0.1310 | 0.3929 | 9.8 | 8ajy:D |
5 | 4f2f:A | 100 | 19 | 0.0466 | 0.1100 | 0.5789 | 0.88 | |
6 | 2qag:B | 246 | 85 | 0.0975 | 0.0935 | 0.2706 | 2.3 | |
7 | 5cxw:A | 376 | 138 | 0.1441 | 0.0904 | 0.2464 | 3.4 | |
8 | 6lpf:B | 1006 | 104 | 0.1229 | 0.0288 | 0.2788 | 3.5 | 6kid:A, 6kie:A, 6kqy:A, 6kr7:A, 6lpf:A, 6lr6:A, 6lr6:B |
9 | 3kx2:B | 755 | 128 | 0.1441 | 0.0450 | 0.2656 | 5.1 | 5i8q:A, 5i8q:B, 5jpt:A, 5jpt:B, 3kx2:A, 2xau:A, 2xau:B, 5y88:W |
10 | 3pyz:A | 410 | 83 | 0.1102 | 0.0634 | 0.3133 | 6.3 | 3n2a:A, 3qcz:A |
11 | 2vh3:B | 113 | 20 | 0.0381 | 0.0796 | 0.4500 | 7.0 | 2vh3:A |
12 | 8qxc:L | 214 | 56 | 0.0763 | 0.0841 | 0.3214 | 7.5 | 1axs:L, 1axs:A, 1d6v:L, 8qxc:B, 6xli:B, 6xli:D, 6xli:L, 6xtg:L, 6xuk:L |
13 | 6s8r:A | 167 | 60 | 0.0720 | 0.1018 | 0.2833 | 8.5 |