BioLiP

>protein
NTLRPVTIRQILNAEQPHPDAEFILDGAELGQLTFVAVVRNISRNATNVAYSVEDGTGQIEVRQWLDASEIRNNVYVRVL
GTLKSFQNRRSISSGHMRPVIDYNEVMFHRLEAVHAHLQVTR

The query sequence (length=122) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4gnx:B	122	122	1.0000	1.0000	1.0000	5.29e-88	4gnx:Y, 4gop:B, 4gop:Y
2	6i52:B	132	119	0.4180	0.3864	0.4286	6.31e-31
3	5u7w:A	404	72	0.1557	0.0470	0.2639	0.50	5u7v:A
4	6t4h:A	771	54	0.1230	0.0195	0.2778	1.7
5	7aor:z	1071	31	0.0902	0.0103	0.3548	2.0
6	2ckj:A	1264	29	0.0656	0.0063	0.2759	4.0
7	2e1q:A	1307	29	0.0656	0.0061	0.2759	4.0	6a7x:A, 6a7x:B, 6abu:A, 6abu:B, 6ac1:A, 6ac1:B, 6ac4:A, 6ac4:B, 6ad4:A, 6ad4:B, 6adj:A, 6adj:B, 6aju:A, 6aju:F, 3an1:A, 3an1:B, 3b9j:A, 3b9j:I, 2ckj:B, 2ckj:C, 2ckj:D, 2e1q:B, 2e1q:C, 2e1q:D, 2e3t:A, 2e3t:B, 3etr:A, 3etr:L, 3eub:A, 3eub:J, 3eub:S, 3eub:2, 1fiq:A, 3nrz:A, 3nrz:J, 3ns1:A, 3ns1:J, 3nvv:A, 3nvv:J, 3nvw:A, 3nvw:J, 3nvy:A, 3nvy:J, 3nvz:A, 3nvz:J, 3sr6:A, 3sr6:J, 1wyg:A, 4yrw:A, 4yrw:B, 4ysw:A, 4ysw:B, 4yty:A, 4yty:B, 4ytz:A, 4ytz:B
8	6z6b:PPP	2036	48	0.1230	0.0074	0.3125	5.2	6z6b:EEE
9	4d0t:A	496	71	0.1721	0.0423	0.2958	5.9	5ajn:A, 5ajo:A, 5ajp:A, 4d0t:C, 4d0t:F, 4d0t:B, 4d0t:D, 4d0t:E, 4d0z:B, 4d0z:E, 4d0z:A, 4d0z:C, 4d0z:D, 4d0z:F, 4d11:D, 4d11:E, 4d11:B, 4d11:A, 4d11:F, 6e7i:A, 6egs:A, 6egs:B, 2ffu:A, 2ffv:A, 2ffv:B, 5fv9:A, 5fv9:B, 5fv9:C, 5fv9:D, 5fv9:E, 5fv9:F, 5ndf:A, 5ndf:B, 5ndf:C, 5ndf:D, 5ndf:E, 5ndf:F, 6nqt:A, 6nqt:B, 6nqt:C, 6nqt:D, 6nqt:E, 6nqt:F
10	6hiv:Cv	1059	113	0.2131	0.0246	0.2301	6.2	6hiw:Cv, 6hiy:Cv, 7pub:Cv
11	4d11:C	436	71	0.1721	0.0482	0.2958	7.1
12	4gox:A	275	63	0.1230	0.0545	0.2381	7.4

[Back]