NTKSAAARARRAEAKAAADAKKQKELEDAYWKDDDKHVMRKEQRKEEKEKRRLDQLERKKETQRLLEEEDSKL
The query sequence (length=73) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 6zm7:CE | 124 | 73 | 1.0000 | 0.5887 | 1.0000 | 7.40e-43 | 8k2c:CE, 8xsy:CE, 6z6l:CE, 6zme:CE |
| 2 | 6ahr:B | 774 | 60 | 0.2466 | 0.0233 | 0.3000 | 4.0 | 6ahu:B |
| 3 | 8db4:E | 95 | 48 | 0.2055 | 0.1579 | 0.3125 | 4.8 | |
| 4 | 7pub:F6 | 416 | 35 | 0.1918 | 0.0337 | 0.4000 | 5.8 | |
| 5 | 6yjb:A | 309 | 51 | 0.2055 | 0.0485 | 0.2941 | 7.9 | 6ykf:A, 6ymg:A, 6ymg:B |
umich.edu