NTKPSLLPPPVGNPPPVISYPFQITLASLGTEDAADSVSIASNSVLATYTALYRHAQLKHLKATIHPTYMAPKYPTSVAL
VWVPANSTATSTQVLDTYGGLHFCIGGSVNSVKPIDVEANLTNLNPIIKASTTFTDTPKLLYYSKAQATAPTSPTCYLTI
QGQIELSSPLLQASS
The query sequence (length=175) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1ddl:A | 188 | 175 | 1.0000 | 0.9309 | 1.0000 | 1.91e-125 | 1ddl:B, 1ddl:C |
2 | 2xpj:C | 185 | 170 | 0.4229 | 0.4000 | 0.4353 | 3.41e-40 | |
3 | 2y4o:A | 433 | 81 | 0.1314 | 0.0531 | 0.2840 | 0.17 | 2y4o:B |
4 | 7all:AAA | 498 | 97 | 0.1429 | 0.0502 | 0.2577 | 0.34 | |
5 | 6gk5:A | 403 | 38 | 0.0629 | 0.0273 | 0.2895 | 6.4 | 6gk6:A |