NTDITALEKAQYPVVDRNPAFTKVVGNFSTLDYLRFSTITGISVTVGYLSGIKPGIKGPSMVTGGLIGLMGGFMYAYQNS
AGRLMGFFPNDGEVASYQK
The query sequence (length=99) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7aqq:f | 101 | 99 | 1.0000 | 0.9802 | 1.0000 | 9.37e-69 | 7a23:c, 7a24:c, 7ar7:f, 7ar8:f, 7arb:f, 8bef:f, 8bpx:f, 8bq5:f, 8bq6:f |
2 | 6y79:X | 167 | 89 | 0.2525 | 0.1497 | 0.2809 | 0.011 | 7zkp:X |
3 | 6y2c:B | 84 | 34 | 0.1313 | 0.1548 | 0.3824 | 0.52 | |
4 | 1j4w:A | 145 | 34 | 0.1313 | 0.0897 | 0.3824 | 1.0 | 6y2c:A |
5 | 3cf4:A | 766 | 25 | 0.1010 | 0.0131 | 0.4000 | 1.7 | |
6 | 2xmr:A | 281 | 54 | 0.1818 | 0.0641 | 0.3333 | 2.3 | |
7 | 7og0:B | 498 | 19 | 0.0909 | 0.0181 | 0.4737 | 8.6 | 7ofw:A, 7ofz:A, 7og0:A |