BioLiP

>protein
NSRTRPRVGHIQFLSCLPLYWGLARTGTLLDFELTKDTPEKLSEQLVRGDLDIGPVTLVEFLKNADDLVAFPDIAVGCDG
PVMSCVIVSQVPLDRLDGARVALGSTSRTSVRLAQLLLSERFGVQPDYYTCPPDLSLMMQEADAAVLIGDAALRANMIDG
PRYGLDVHDLGALWKEWTGLPFVFAVWAARRDYAEREPVITRKVHEAFLASRNLSLEEVEKVAEQAARWEAFDEDTLAKY
FTTLDFRFGAPQLEAVTEFARRVGPTTGFPADVKVELLKPLE

The query sequence (length=282) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7ahr:B	287	282	0.9965	0.9791	0.9965	0.0	7ahr:A, 7an5:A, 7an5:B, 7an6:A, 7an6:B, 7an7:A, 7an7:B, 7an8:A, 7an8:B, 7an9:A, 7an9:B, 7ywc:A, 7ywc:B
2	6o9a:A	271	237	0.2624	0.2731	0.3122	3.02e-22	6o9a:B
3	3a3u:A	270	209	0.2092	0.2185	0.2823	2.82e-07	2czl:A
4	7w6u:A	597	43	0.0638	0.0302	0.4186	3.5	7w6r:A, 7xby:A
5	6g4d:B	453	117	0.1206	0.0751	0.2906	3.8	7b4i:AAA, 7b4i:BBB, 7b4j:A, 7b4j:B, 6g4d:A, 6g4e:A, 6g4e:B, 6g4f:A, 6g4f:B, 6tb0:A, 6tb0:B, 6tb1:A, 6tb1:B
6	6ssy:A	298	143	0.1206	0.1141	0.2378	4.2	6ssy:B, 6st0:A, 6st0:B
7	3oi8:A	156	34	0.0532	0.0962	0.4412	4.5	3oi8:B
8	5kr3:A	458	113	0.0993	0.0611	0.2478	4.7	5kr3:B, 5kr4:A, 5kr4:B, 5kr5:A, 5kr5:B
9	8the:A	712	48	0.0532	0.0211	0.3125	6.1
10	4xqk:A	1517	92	0.0816	0.0152	0.2500	6.2	4xqk:B
11	1eb6:A	177	60	0.0674	0.1073	0.3167	6.9
12	8umv:D	329	46	0.0603	0.0517	0.3696	7.1	8ui7:D, 8ui8:D, 8ui9:D, 8uii:D, 8umt:D, 8umw:D, 8umy:D, 8un0:D, 8unj:D, 6vvo:D, 7z6h:D
13	1obf:O	335	39	0.0496	0.0418	0.3590	7.6	1obf:P
14	1jlk:A	141	51	0.0674	0.1348	0.3725	7.9
15	4fln:B	464	23	0.0390	0.0237	0.4783	9.0	4fln:A, 4fln:C
16	3lez:A	260	50	0.0567	0.0615	0.3200	9.1

[Back]