NSEEDYPNGTWLGDENNPEMRVRCAIIPSDMLHISTNCRTAEKMALTLLDYLFHREVQAVSNLSGQGKHGKKQLDPLTIY
GIRCHLFYKFGITESDWYRIKQSIDSKCRTAWRRKQR
The query sequence (length=117) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8yzt:C | 121 | 117 | 1.0000 | 0.9669 | 1.0000 | 7.78e-88 | 8htx:A, 8htx:B, 7yuk:A, 8yzt:D, 8yzt:A |
2 | 6ach:A | 364 | 18 | 0.0769 | 0.0247 | 0.5000 | 5.4 | 6ach:B, 6ach:C, 6ach:D, 6ach:E, 6ach:F, 6ach:G, 6ach:H |
3 | 7ypp:A | 165 | 21 | 0.0769 | 0.0545 | 0.4286 | 5.5 | 7ypp:C, 7ypp:D, 7ypp:E, 7ypp:B, 7ypp:F, 7ypr:A, 7ypr:B, 7ypr:C, 7ypr:D, 7ypr:E, 7ypr:F |
4 | 8aa2:G | 435 | 18 | 0.0684 | 0.0184 | 0.4444 | 6.2 | |
5 | 9em9:A | 512 | 40 | 0.0940 | 0.0215 | 0.2750 | 8.9 | 9em9:B |