NRRNKARKVVSRSTALVPMAPASQRTGPAPRKPRKRNQALVRNPRLTDAGLAFLKCAFAAPDFSVDPGKGIPDNFHGRTL
AIKDCNTTSVVFTPNTDTYIVVAPVPGFAYFRAEVAVGAQPTTFVGVPYPTYATNFGAGSQNGLPAVNNYSKFRYASMAC
GLYPTSNMMQFSGSVQVWRVDLNLSEAVNPAVTAITPAPGVFANFVDKRINGLRGIRPLAPRDNYSGNFIDGAYTFAFDK
STDFEWCDFVRSLEFSESNVLGAATAMKLLAPGGGTDTTLTGLGNVNTLVYKISTPTGAVNTAILRTWNCIELQPYTDSA
LFQFSGVSPPFDPLALECYHNLKMRFPVAVSSREN
The query sequence (length=355) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1f8v:A | 355 | 355 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 1f8v:B, 1f8v:C |
2 | 2bbv:C | 321 | 316 | 0.3746 | 0.4143 | 0.4209 | 1.75e-75 | 2bbv:A, 2bbv:B |
3 | 4fte:B | 330 | 316 | 0.3662 | 0.3939 | 0.4114 | 1.02e-72 | 4fsj:A, 4fsj:B, 4fsj:C, 4ftb:A, 4ftb:B, 4ftb:C, 4fte:C, 4fte:A, 4fts:C, 4fts:A, 4fts:B, 3lob:C |
4 | 1nov:C | 324 | 320 | 0.3577 | 0.3920 | 0.3969 | 2.46e-69 | 1nov:A, 1nov:B |
5 | 8wev:A | 486 | 51 | 0.0507 | 0.0370 | 0.3529 | 0.61 | 8wev:B |
6 | 7n63:A | 362 | 51 | 0.0507 | 0.0497 | 0.3529 | 1.4 | |
7 | 8p5d:LT0 | 156 | 37 | 0.0451 | 0.1026 | 0.4324 | 2.1 | 8p60:LT0, 8p60:KT0, 7qca:LT0 |
8 | 6yjs:BBB | 486 | 25 | 0.0394 | 0.0288 | 0.5600 | 6.0 | 6yjs:AAA |
9 | 6yjt:AAA | 513 | 25 | 0.0394 | 0.0273 | 0.5600 | 6.1 | 8ce3:A, 6yjt:BBB, 6yju:AAA, 6yju:BBB, 6yjv:AAA, 6yjv:BBB, 5zic:B |
10 | 4pse:A | 220 | 120 | 0.0817 | 0.1318 | 0.2417 | 7.6 | 4pse:B |
11 | 5kzm:B | 395 | 78 | 0.0648 | 0.0582 | 0.2949 | 9.4 |