BioLiP

>protein
NRPPIAIVSPQFQEISLPTTSTVIDGSQSTDDDKIVQYHWEELKGPLREEKISEDTAILKLSKLVPGNYTFSLTVVDSDG
ATNSTTANLTVNKAV

The query sequence (length=95) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6nz0:Z	95	95	1.0000	1.0000	1.0000	7.40e-66
2	2c26:A	250	73	0.2526	0.0960	0.3288	0.10	2c4x:A
3	6aem:A	84	51	0.1789	0.2024	0.3333	0.86	6aem:B
4	7stm:A	801	47	0.1684	0.0200	0.3404	1.1	7stm:B, 7stn:A, 7stn:B, 7sto:B, 7sto:A
5	8jzs:B	486	37	0.1579	0.0309	0.4054	1.2	8jzs:A, 8jzu:A, 8wx4:B, 8wx4:A
6	3las:A	166	31	0.1368	0.0783	0.4194	2.0	3las:B
7	6d41:B	579	51	0.1895	0.0311	0.3529	2.4	6d41:A, 6d6w:A, 6d6w:B, 6d6w:C, 6d6w:D, 6d7f:A, 6d7f:B, 6d7f:C, 6d7f:D, 6d7f:E, 6d7f:F
8	2qdg:A	366	63	0.1789	0.0464	0.2698	2.8	2qap:A, 2qap:B, 2qap:C, 2qap:D, 2qdg:B, 2qdg:C, 2qdg:D, 2qdh:A, 2qdh:B, 2qdh:C, 2qdh:D
9	8hub:C	572	32	0.1263	0.0210	0.3750	3.8	8hub:D
10	4lxo:A	184	43	0.1158	0.0598	0.2558	3.9	4lxo:B
11	8hub:B	545	32	0.1263	0.0220	0.3750	3.9
12	8hu6:B	629	32	0.1263	0.0191	0.3750	4.0	8hu6:A, 8hu6:C, 8hu6:D
13	7qx0:B	443	61	0.1895	0.0406	0.2951	4.5	7qx0:A, 7qx0:C, 7qx0:D, 7qx3:B, 7qx3:C, 7qx3:A, 7qx3:D
14	6dlh:A	704	16	0.1158	0.0156	0.6875	4.8	6dms:A, 6dns:A
15	5jon:A	509	48	0.1789	0.0334	0.3542	8.0	5jon:B
16	7c7u:A	579	59	0.1895	0.0311	0.3051	8.0	7c7r:B, 7c7r:A, 7c7u:B
17	5xxz:B	1310	31	0.1053	0.0076	0.3226	8.6
18	5xya:A	1358	31	0.1053	0.0074	0.3226	9.4	5xxz:A
19	7edd:A	1394	31	0.1053	0.0072	0.3226	9.9	5xyr:A

[Back]