BioLiP

>protein
NRIPLGCTICRKRKVKCDKLRPHCQQCTKTGVAHLCHYMEQTWAEEAEKELLKDNELKKLRERVKSLEKTL

The query sequence (length=71) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2hap:C	76	71	0.9859	0.9211	0.9859	4.00e-46	2hap:D, 1hwt:C, 1hwt:D, 1hwt:G, 1hwt:H, 1pyc:A, 1qp9:A, 1qp9:B, 1qp9:C, 1qp9:D
2	6gys:B	579	48	0.2535	0.0311	0.3750	4.10e-05	6f07:B, 6gyp:B, 6gys:C, 6gys:J, 6gys:I, 6gyu:B, 7k7g:M, 8ow1:CE
3	3coq:A	89	37	0.2113	0.1685	0.4054	0.029	3coq:B, 1d66:A, 1d66:B, 7uik:T, 7uik:U, 7uio:GA, 7uio:GB
4	1aw6:A	43	31	0.1831	0.3023	0.4194	0.052
5	1ajy:A	71	40	0.1972	0.1972	0.3500	0.090	1ajy:B, 1zme:C, 1zme:D
6	1pyi:A	88	27	0.1690	0.1364	0.4444	0.30	1pyi:B
7	1cld:A	33	27	0.1690	0.3636	0.4444	0.66
8	2yfn:A	719	31	0.1549	0.0153	0.3548	2.0	2yfo:A
9	7qbu:A	418	60	0.2676	0.0455	0.3167	3.7	7qbs:A, 7qbt:A, 7qbt:B, 7qbt:C, 7qbt:D, 7qbu:B, 7qbv:A, 7qbv:B, 7qbv:C, 7qbv:D
10	4ail:C	750	31	0.1549	0.0147	0.3548	5.2	2jgu:A
11	4n78:A	1184	43	0.1408	0.0084	0.2326	8.4
12	6dcr:B	600	34	0.1831	0.0217	0.3824	9.0
13	8fak:H	643	34	0.1831	0.0202	0.3824	9.7	2d7g:A, 2d7g:B, 2d7g:C, 2d7g:D, 2d7h:A, 6dcr:A, 2dwl:A, 2dwl:B, 2dwl:C, 2dwl:D, 2dwm:A, 2dwm:C, 2dwm:D, 2dwn:A, 2dwn:C

[Back]