NRFTVAELKQLVARPDVVEMHDVTAQDPKLLVHLKATRNSVPVPRHWCFKRKYLQGKRGIEKPPFELPDFIKRTGIQIDI
DYQKLHDAFFKWQTKPKLTIHGDLYYEGKEFEGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSYPNLKIPGLN
SPIPPLYGDVFGTNAAEIDRTPWGELE
The query sequence (length=187) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7vpx:2 | 187 | 187 | 1.0000 | 1.0000 | 1.0000 | 4.28e-139 | 7evo:2, 8hk1:2, 7onb:I, 7q4o:B, 7q4p:B, 6y50:8 |
2 | 8i0r:2 | 250 | 246 | 0.9786 | 0.7320 | 0.7439 | 5.14e-120 | 8ch6:E, 6ff4:8, 6ff7:8, 8i0p:2, 8i0s:2, 8i0t:2, 8i0u:2, 8i0v:2, 8qo9:B2, 7qtt:E, 6qx9:B2, 8qxd:B2, 8r08:B2, 8r0a:B2, 8r0b:B2 |
3 | 7dvq:2 | 216 | 232 | 0.9144 | 0.7917 | 0.7371 | 2.55e-108 | 7abh:T, 7abi:T, 8y7e:2, 5z56:2, 5z57:2, 5z58:2 |
4 | 7q3l:B | 110 | 111 | 0.5080 | 0.8636 | 0.8559 | 3.68e-61 | |
5 | 7q3l:B | 110 | 27 | 0.0642 | 0.1091 | 0.4444 | 0.37 | |
6 | 7dco:2 | 220 | 211 | 0.4225 | 0.3591 | 0.3744 | 2.41e-36 | 6g90:Q, 5gm6:H, 5nrl:Q, 5zwm:2 |
7 | 5en7:A | 177 | 39 | 0.0695 | 0.0734 | 0.3333 | 1.9 | 5en6:A, 5en7:C, 5en7:E, 5en7:G |
8 | 1gxu:A | 88 | 47 | 0.0749 | 0.1591 | 0.2979 | 4.6 |