BioLiP

>protein
NRFTVAELKQLVARPDVVEMHDVTAQDPKLLVHLKATRNSVPVPRHWCFKRKYLQGKRGIEKPPFELPDFIKRTGIQEMR
EALQEKEEQKTMKSKMREKVRPKMGKIDIDYQKLHDAFFKWQTKPKLTIHGDLYYEGKEFETRLKKPGDLSDELRISLGM
PVGPNAHKVPPPWLIAMQRYGPPPSYPNLKIPGLNSPIPESCSFGYHA

The query sequence (length=208) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8i0r:2	250	210	1.0000	0.8320	0.9905	4.34e-153	8ch6:E, 6ff4:8, 6ff7:8, 8i0p:2, 8i0s:2, 8i0t:2, 8i0u:2, 8i0v:2, 8qo9:B2, 7qtt:E, 6qx9:B2, 8qxd:B2, 8r08:B2, 8r0a:B2, 8r0b:B2
2	7dvq:2	216	204	0.9135	0.8796	0.9314	3.00e-134	7abh:T, 7abi:T, 8y7e:2, 5z56:2, 5z57:2, 5z58:2
3	7vpx:2	187	199	0.7885	0.8770	0.8241	1.10e-112	7evo:2, 8hk1:2, 7onb:I, 7q4o:B, 7q4p:B, 6y50:8
4	7q3l:B	110	143	0.4615	0.8727	0.6713	3.20e-57
5	7dco:2	220	206	0.4231	0.4000	0.4272	1.17e-47	6g90:Q, 5gm6:H, 5nrl:Q, 5zwm:2
6	1gxu:A	88	28	0.0529	0.1250	0.3929	0.17
7	7s7b:F	352	54	0.0913	0.0540	0.3519	0.36	7s7b:B, 7s7c:B
8	7f8d:A	313	52	0.0817	0.0543	0.3269	2.2	7by9:A, 7by9:B, 7by9:C, 7by9:D, 7bya:A, 7bya:B, 7bya:C, 7bya:D, 7f8d:B, 7f8d:C, 7f8d:D, 7x1l:A, 7x1l:B, 7x1l:E, 7x1l:F, 7x1l:C, 7x1l:D
9	6w6h:C	636	99	0.1202	0.0393	0.2525	4.1	6w6e:B, 6w6e:C, 6w6g:A, 6w6g:B, 6w6g:C, 6w6h:A, 6w6h:B, 6w6h:F, 6w6i:A, 6w6i:B, 6w6i:C, 6w6j:A, 6w6j:B, 6w6j:C
10	6ct6:B	331	62	0.0721	0.0453	0.2419	4.4	6ct6:A

[Back]