BioLiP

>protein
NRFTVAELKQLVARPDVVEMHDVTAQDPKLLVHLKATRNSVPVPRHWCFKRKYLQGKRGIEKPPFELPDFIKRTGIQEMR
EALQEKEEQKTMKSKMREKVRPKMGKIDIDYQKLHDAFFKWQTKPKLTIHGDLYYEGKEFETRL

The query sequence (length=144) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7dvq:2	216	144	1.0000	0.6667	1.0000	1.23e-104	7abh:T, 7abi:T, 8y7e:2, 5z56:2, 5z57:2, 5z58:2
2	8i0r:2	250	144	1.0000	0.5760	1.0000	1.06e-103	8ch6:E, 6ff4:8, 6ff7:8, 8i0p:2, 8i0s:2, 8i0t:2, 8i0u:2, 8i0v:2, 8qo9:B2, 7qtt:E, 6qx9:B2, 8qxd:B2, 8r08:B2, 8r0a:B2, 8r0b:B2
3	7vpx:2	187	144	0.7847	0.6043	0.7847	2.22e-75	7evo:2, 8hk1:2, 7onb:I, 7q4o:B, 7q4p:B, 6y50:8
4	7q3l:B	110	143	0.6667	0.8727	0.6713	1.41e-58
5	7dco:2	220	140	0.4306	0.2818	0.4429	7.24e-37	6g90:Q, 5gm6:H, 5nrl:Q, 5zwm:2
6	1gxu:A	88	26	0.0764	0.1250	0.4231	0.30
7	7f8d:A	313	52	0.1181	0.0543	0.3269	0.94	7by9:A, 7by9:B, 7by9:C, 7by9:D, 7bya:A, 7bya:B, 7bya:C, 7bya:D, 7f8d:B, 7f8d:C, 7f8d:D, 7x1l:A, 7x1l:B, 7x1l:E, 7x1l:F, 7x1l:C, 7x1l:D
8	6ct6:B	331	62	0.1042	0.0453	0.2419	3.7	6ct6:A
9	5zk4:A	287	50	0.1111	0.0557	0.3200	6.7	6apg:A, 6apg:B, 3sbm:A, 5zk4:B
10	1rjw:A	339	57	0.1250	0.0531	0.3158	7.0	3pii:A, 3pii:C, 3pii:B, 3pii:D, 1rjw:B, 1rjw:C, 1rjw:D
11	4xww:A	545	44	0.0833	0.0220	0.2727	8.5	4xwt:A, 4xwt:B, 4xww:B

[Back]