BioLiP

>protein
NRFTVAELKQLVARPDVVEMHDVTAQDPKLLVHLKATRNSVPVPRHWCFKRKYLQGKRGIEKPPFELPDFIKRTGIQDYQ
KLHDAFFKWQTKPKLTIHGDLYYEGKEFDRTPWGELE

The query sequence (length=117) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7vpx:2	187	112	0.9231	0.5775	0.9643	7.23e-75	7evo:2, 8hk1:2, 7onb:I, 7q4o:B, 7q4p:B, 6y50:8
2	7vpx:2	187	28	0.1111	0.0695	0.4643	0.47	7evo:2, 8hk1:2, 7onb:I, 7q4o:B, 7q4p:B, 6y50:8
3	7dvq:2	216	141	0.9231	0.5000	0.7660	2.91e-71	7abh:T, 7abi:T, 8y7e:2, 5z56:2, 5z57:2, 5z58:2
4	7dvq:2	216	14	0.0940	0.0509	0.7857	1.7	7abh:T, 7abi:T, 8y7e:2, 5z56:2, 5z57:2, 5z58:2
5	8i0r:2	250	141	0.9231	0.4320	0.7660	4.24e-70	8ch6:E, 6ff4:8, 6ff7:8, 8i0p:2, 8i0s:2, 8i0t:2, 8i0u:2, 8i0v:2, 8qo9:B2, 7qtt:E, 6qx9:B2, 8qxd:B2, 8r08:B2, 8r0a:B2, 8r0b:B2
6	8i0r:2	250	21	0.0940	0.0440	0.5238	6.0	8ch6:E, 6ff4:8, 6ff7:8, 8i0p:2, 8i0s:2, 8i0t:2, 8i0u:2, 8i0v:2, 8qo9:B2, 7qtt:E, 6qx9:B2, 8qxd:B2, 8r08:B2, 8r0a:B2, 8r0b:B2
7	7q3l:B	110	117	0.8803	0.9364	0.8803	1.64e-67
8	7dco:2	220	145	0.4444	0.2364	0.3586	5.01e-23	6g90:Q, 5gm6:H, 5nrl:Q, 5zwm:2
9	5zk4:A	287	50	0.1368	0.0557	0.3200	4.0	6apg:A, 6apg:B, 3sbm:A, 5zk4:B
10	1pdn:C	123	44	0.1111	0.1057	0.2955	5.4
11	8ei2:A	358	47	0.1111	0.0363	0.2766	7.0

[Back]