BioLiP

>protein
NRELTYITNSIAEAQRVMAAMLADERLLATVRKVADACIASIAQGGKVLLAGNGGSAADAQHIAGQFVSRFAFDRPGLPA
VALTTDTSILTAIGNDYGYEKLFSRQVQALGNEGDVLIGYSTSGKSPNILAAFREAKAKGMTCVGFTGNRGGEMRELCDL
LLEVPSADTPKIQEGHLVLGHIVCGLVEHSIFG

The query sequence (length=193) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2x3y:A	202	193	0.9948	0.9505	0.9948	1.00e-141	5ltz:A, 5ltz:B, 5ltz:D, 5ltz:C, 5lu5:A, 5lu5:B, 5lu5:C, 5lu5:D, 5lu6:A, 5lu6:B, 5lu6:C, 5lu6:D, 5lu7:A, 5lu7:B, 5lu7:D, 5lu7:C, 8v2t:A, 8v4j:A, 2x3y:B, 2x3y:C, 2x3y:D, 2x3y:E, 2x3y:F, 2x3y:G, 2x3y:H, 2xbl:A, 2xbl:B, 2xbl:D, 2xbl:C
2	1x92:B	197	172	0.3938	0.3858	0.4419	3.99e-47	1x92:A
3	5i01:A	184	178	0.4041	0.4239	0.4382	3.44e-43	5i01:B, 5i01:C, 5i01:D
4	2i22:B	178	186	0.3627	0.3933	0.3763	1.41e-35	2i22:C
5	4lzj:B	299	143	0.1658	0.1070	0.2238	1.93e-04	4lzj:C, 4lzj:D, 4lzj:A
6	5uqi:A	188	160	0.2073	0.2128	0.2500	0.001
7	8fdb:B	333	49	0.0881	0.0511	0.3469	0.001	8eym:A, 8eym:B, 8fdb:A
8	8tx9:A	190	73	0.1088	0.1105	0.2877	0.053	8tx9:B, 8tx9:C, 8tx9:D
9	8zmr:A	384	97	0.1347	0.0677	0.2680	0.098
10	4heq:A	145	72	0.1244	0.1655	0.3333	0.71	4heq:B
11	6s9u:A	520	92	0.1088	0.0404	0.2283	1.3
12	8gm4:A	462	63	0.0933	0.0390	0.2857	2.0
13	3jrv:B	144	49	0.0829	0.1111	0.3265	2.5	3jrv:A
14	1on3:E	520	136	0.1606	0.0596	0.2279	8.7	1on3:A, 1on3:D, 1on3:B, 1on3:C, 1on3:F, 1on9:A, 1on9:B, 1on9:C, 1on9:D, 1on9:E, 1on9:F
15	4d26:A	430	74	0.0984	0.0442	0.2568	9.9	4d25:A

[Back]