BioLiP

>protein
NRELTYITNSIAEAQRVMAAMLADERLLATVRKVADACIASIAQGGKVLLAGNGGSAADAQHIAGEFVSRFAFDRPGLPA
VALTTDTSILTAIGNDYGYEKLFSRQVQALGNEGDVLIGYSTSGKSPNILAAFREAKAKGMTCVGFTGNRGGEMRELCDL
LLEVPSADTPKIQEGHLVLGHIVCGLVEHSIFG

The query sequence (length=193) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2x3y:A	202	193	1.0000	0.9554	1.0000	4.81e-142	5ltz:A, 5ltz:B, 5ltz:D, 5ltz:C, 5lu5:A, 5lu5:B, 5lu5:C, 5lu5:D, 5lu6:A, 5lu6:B, 5lu6:C, 5lu6:D, 5lu7:A, 5lu7:B, 5lu7:D, 5lu7:C, 8v2t:A, 8v4j:A, 2x3y:B, 2x3y:C, 2x3y:D, 2x3y:E, 2x3y:F, 2x3y:G, 2x3y:H, 2xbl:A, 2xbl:B, 2xbl:D, 2xbl:C
2	1x92:B	197	172	0.3990	0.3909	0.4477	1.11e-47	1x92:A
3	5i01:A	184	178	0.4093	0.4293	0.4438	1.05e-43	5i01:B, 5i01:C, 5i01:D
4	2i22:B	178	186	0.3679	0.3989	0.3817	5.64e-36	2i22:C
5	4lzj:B	299	143	0.1710	0.1104	0.2308	6.47e-05	4lzj:C, 4lzj:D, 4lzj:A
6	5uqi:A	188	160	0.2073	0.2128	0.2500	0.001
7	8fdb:B	333	49	0.0881	0.0511	0.3469	0.001	8eym:A, 8eym:B, 8fdb:A
8	8tx9:A	190	73	0.1088	0.1105	0.2877	0.053	8tx9:B, 8tx9:C, 8tx9:D
9	8zmr:A	384	97	0.1347	0.0677	0.2680	0.085
10	4heq:A	145	72	0.1244	0.1655	0.3333	0.53	4heq:B
11	6s9u:A	520	92	0.1140	0.0423	0.2391	0.54
12	3jrv:B	144	49	0.0829	0.1111	0.3265	2.5	3jrv:A
13	8cnr:A	548	81	0.1399	0.0493	0.3333	4.7	8cns:A

[Back]