BioLiP

>protein
NQIKEQTIFDHKGNVIKTEDREIQIISKFEEPLIVVLGNVLSDEECDELIELSKSKLARSKVGSSNDIRTSSGAFLDDNE
LTAKIEKRISSIMNVPASHGEGLHILNYEVDQQYKAHYDYFAEHSRSAANNRISTLVMYLNDVEEGGETFFPKLNLSVHP
RKGMAVYFEYFYQDQSLNELTLHGGAPVTKGEKWIATQWVRRGTYK

The query sequence (length=206) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5v7y:A	207	206	0.9854	0.9807	0.9854	3.59e-151	5hv0:A, 5hv0:B, 5hv4:A, 5iav:A, 5iav:B, 5iax:A, 5iax:B, 5v7y:B, 5v7y:D, 5v7y:C
2	2jig:A	216	196	0.3641	0.3472	0.3827	2.84e-38	3gze:A, 3gze:C
3	2jig:B	195	189	0.3301	0.3487	0.3598	4.53e-33	3gze:B, 3gze:D
4	5c5u:B	190	176	0.2767	0.3000	0.3239	3.33e-19	5c5t:A, 5c5t:B, 5c5u:A
5	6tp5:A	370	216	0.2864	0.1595	0.2731	3.60e-11	6tp5:B
6	6tp5:A	370	53	0.0874	0.0486	0.3396	1.8	6tp5:B
7	3jvt:C	156	51	0.1068	0.1410	0.4314	2.0	1b7t:Z, 1dfk:Z, 1dfl:Z, 1dfl:X, 2ec6:C, 1kk7:Z, 1kk8:C, 1kqm:C, 1kwo:C, 1l2o:C, 2os8:C, 2otg:C, 3pn7:C, 3pn7:F, 1qvi:Z, 1s5g:Z, 1scm:C, 1sr6:C, 3ts5:C, 3ts5:F, 3tuy:C, 3tuy:F, 1wdc:C
8	7na0:A	981	72	0.1068	0.0224	0.3056	3.8	7na0:B, 4nm9:A, 4nm9:B, 4nma:A, 4nma:B, 4nmb:A, 4nmb:B, 4nmc:B, 4nmd:A, 4nmd:B, 4nme:A, 4nme:B, 4nmf:A, 4nmf:B
9	4nmc:A	941	72	0.1068	0.0234	0.3056	3.8
10	6jdc:A	269	83	0.1214	0.0929	0.3012	4.2
11	6jdb:A	290	83	0.1214	0.0862	0.3012	4.2
12	2vhl:B	393	41	0.0728	0.0382	0.3659	8.0	2vhl:A
13	8cip:A	665	59	0.0874	0.0271	0.3051	9.9	8cip:B, 8cip:C, 8cip:D

[Back]