NPYIYLGGAILAEVIGTTLMKFSNGFTRLIPSMGTIICYCASFWLLAQTLAYIPTGIAYAIWSGVGIVLISLLSWGFFGQ
RLDLPAIIGMMLICAGVLIINLL
The query sequence (length=103) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8uoz:A | 110 | 103 | 0.9709 | 0.9091 | 0.9709 | 3.53e-66 | 7jk8:A, 7jk8:B, 7mgx:A, 7mgx:B, 7mgx:E, 7mgx:F, 7sfq:A, 7sfq:B, 7ssu:A, 7ssu:B, 7sv9:B, 7sv9:A, 7svx:B, 8uoz:B |
2 | 7szt:A | 104 | 86 | 0.3592 | 0.3558 | 0.4302 | 2.83e-15 | 8tgy:A, 8tgy:E, 8vxu:A, 8vxu:B, 8vxu:C, 8vxu:D, 6wk8:B, 6wk8:A, 6wk9:B, 6wk9:A, 6wk9:F, 6wk9:E |
3 | 5sy1:A | 582 | 87 | 0.2330 | 0.0412 | 0.2759 | 0.58 | 5sy1:B |
4 | 2f57:B | 300 | 84 | 0.1553 | 0.0533 | 0.1905 | 1.1 |