NPWTEYMAKYDIEEVHGSGIRVDLGEDAEVAGTQYRLPSGKCPVFGKGIIIENSKTTFLKPVATGNQDLKDGGFAFPPTE
PLISPMTLNGMRDFYKNNEYVKNLDELTLCSRHAGNMNPDKDENSNYKYPAVYDDKDKKCHILYIAAQENNGPMFCFRPA
KDKSFQNYVYLSKNVVDNWEKVCPRKNLENAKFGLWVDGNCEDIPHVNEFSANDLFECNKLVFELSASDQPDRYKSHGKG
YNWGNYNRKTHKCEIFNVKPTCLINDKSYIATTALSHPIEVENNFP
The query sequence (length=286) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3srj:A | 298 | 293 | 0.9371 | 0.8993 | 0.9147 | 0.0 | 3sri:A, 3srj:B, 4z09:A, 4z0d:A, 4z0e:A, 4z0f:A |
2 | 6n87:A | 314 | 315 | 0.9336 | 0.8503 | 0.8476 | 0.0 | |
3 | 6n7q:A | 266 | 282 | 0.8846 | 0.9511 | 0.8972 | 0.0 | |
4 | 4apm:A | 339 | 279 | 0.3671 | 0.3097 | 0.3763 | 4.53e-56 | |
5 | 4yiv:A | 374 | 321 | 0.3357 | 0.2567 | 0.2991 | 3.78e-33 | |
6 | 5e6m:A | 519 | 76 | 0.0664 | 0.0366 | 0.2500 | 2.4 | 4kr2:A, 4kr3:A |
7 | 2atv:A | 168 | 112 | 0.1119 | 0.1905 | 0.2857 | 4.2 | |
8 | 4cu9:B | 185 | 26 | 0.0420 | 0.0649 | 0.4615 | 5.1 | 4cu9:A |
9 | 5m41:A | 712 | 94 | 0.0909 | 0.0365 | 0.2766 | 5.2 |