NPLNDPIMIRTMIVYGNLSATYFTGNGAALTQ
The query sequence (length=32) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 8h2i:da | 32 | 32 | 1.0000 | 1.0000 | 1.0000 | 7.36e-18 | 8h2i:dg |
| 2 | 5xe0:A | 457 | 27 | 0.3438 | 0.0241 | 0.4074 | 1.2 | 5zit:A |
umich.edu