NNTKAMKHALERVQLPWKKHSFQEHQSVTSETNTDEHIKDIYDDTERELAFYKQSLDAVLVARDELKRLKVPFKRPLDYF
AEMVKSDEHMDKIKGKLIEEASDKKAREEARRQRQLKKFGKQVQNATLQKRQLEKRETLEKIKSL
The query sequence (length=145) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8v83:J | 151 | 145 | 1.0000 | 0.9603 | 1.0000 | 3.38e-104 | 6elz:J, 6em5:J, 7nac:J, 7ohr:J, 7r7a:J, 7r7c:J, 8v84:J, 8v87:J |
2 | 8i9t:CU | 178 | 147 | 0.5103 | 0.4157 | 0.5034 | 4.31e-32 | 8i9p:CU, 8i9r:CU, 8i9v:CU, 8i9w:CU, 8i9x:CU, 8i9y:CU, 8i9z:CU, 8ia0:CU |
3 | 8fkr:SN | 173 | 109 | 0.3517 | 0.2948 | 0.4679 | 3.54e-24 | 8fks:SN, 8fkt:SN, 8fku:SN, 8fkv:SN, 8fkw:SN, 8fkx:SN, 8fky:SN |
4 | 8fkp:SN | 168 | 86 | 0.2690 | 0.2321 | 0.4535 | 2.08e-17 | 8fkq:SN |
5 | 6nag:A | 351 | 52 | 0.1310 | 0.0541 | 0.3654 | 0.23 | 5l20:B |
6 | 6dfl:A | 241 | 28 | 0.0897 | 0.0539 | 0.4643 | 1.3 | |
7 | 4jta:Q | 363 | 78 | 0.1793 | 0.0716 | 0.3333 | 1.8 | 4jtc:H, 4jtd:H, 2r9r:H |
8 | 5xe0:A | 457 | 52 | 0.0966 | 0.0306 | 0.2692 | 2.4 | 5zit:A |
9 | 6ezn:F | 650 | 69 | 0.1241 | 0.0277 | 0.2609 | 2.4 | 8agb:A, 8age:A, 6c26:A, 7oci:F |
10 | 8agc:A | 697 | 69 | 0.1241 | 0.0258 | 0.2609 | 2.5 | |
11 | 6cul:A | 267 | 49 | 0.1310 | 0.0712 | 0.3878 | 2.6 | 6cul:B, 6cul:C, 6cul:D, 6cul:E, 6cul:H, 6cul:F, 6cul:G |
12 | 8us3:A | 552 | 44 | 0.1103 | 0.0290 | 0.3636 | 3.0 | 8us1:A |
13 | 5wie:B | 390 | 50 | 0.1172 | 0.0436 | 0.3400 | 3.1 | 4jta:B, 4jtc:B, 4jtd:B, 3lnm:B, 2r9r:B |
14 | 8ch6:V | 285 | 46 | 0.0966 | 0.0491 | 0.3043 | 5.0 | 7qtt:V |
15 | 5wie:H | 328 | 50 | 0.1172 | 0.0518 | 0.3400 | 5.2 | 3lnm:D |
16 | 8i0s:Y | 320 | 46 | 0.0966 | 0.0437 | 0.3043 | 6.2 | 8i0t:Y, 8i0u:Y, 8i0v:Y |
17 | 5dw8:A | 260 | 49 | 0.0966 | 0.0538 | 0.2857 | 8.4 | 5dw8:B, 5j16:A, 5j16:B, 5j16:C, 5j16:D |
18 | 8arn:A | 509 | 38 | 0.1034 | 0.0295 | 0.3947 | 8.5 | 8are:A, 8arn:B |