NNNQIGENKEQTIFDHKGNVIKTEDREIQIISKFEEPLIVVLGNVLSDEECDELIELSKSKLSGAFLDDNELTAKIEKRI
SSIMNVPASHGEGLHILNYEVDQQYKAHYDYFAEHSRSAANNRISTLVMYLNDVEEGGETFFPKLNLSVHPRKGMAVYFE
YFYQDQSLNELTLHGGAPVTKGEKWIATQWVRRGTYK
The query sequence (length=197) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5v7y:A | 207 | 207 | 0.9645 | 0.9179 | 0.9179 | 3.33e-139 | 5hv0:A, 5hv0:B, 5hv4:A, 5iav:A, 5iav:B, 5iax:A, 5iax:B, 5v7y:B, 5v7y:D, 5v7y:C |
2 | 2jig:B | 195 | 177 | 0.3350 | 0.3385 | 0.3729 | 3.04e-33 | 3gze:B, 3gze:D |
3 | 2jig:A | 216 | 196 | 0.3401 | 0.3102 | 0.3418 | 9.67e-33 | 3gze:A, 3gze:C |
4 | 5c5u:B | 190 | 167 | 0.2893 | 0.3000 | 0.3413 | 1.63e-20 | 5c5t:A, 5c5t:B, 5c5u:A |
5 | 6tp5:A | 370 | 147 | 0.2183 | 0.1162 | 0.2925 | 6.42e-11 | 6tp5:B |
6 | 6tp5:A | 370 | 46 | 0.0761 | 0.0405 | 0.3261 | 7.7 | 6tp5:B |
7 | 3jvt:C | 156 | 80 | 0.1421 | 0.1795 | 0.3500 | 0.44 | 1b7t:Z, 1dfk:Z, 1dfl:Z, 1dfl:X, 2ec6:C, 1kk7:Z, 1kk8:C, 1kqm:C, 1kwo:C, 1l2o:C, 2os8:C, 2otg:C, 3pn7:C, 3pn7:F, 1qvi:Z, 1s5g:Z, 1scm:C, 1sr6:C, 3ts5:C, 3ts5:F, 3tuy:C, 3tuy:F, 1wdc:C |
8 | 7naf:y | 167 | 66 | 0.1117 | 0.1317 | 0.3333 | 1.9 | |
9 | 6jdc:A | 269 | 120 | 0.1624 | 0.1190 | 0.2667 | 4.5 | |
10 | 6jdb:A | 290 | 83 | 0.1269 | 0.0862 | 0.3012 | 4.9 | |
11 | 8cip:A | 665 | 59 | 0.0914 | 0.0271 | 0.3051 | 6.4 | 8cip:B, 8cip:C, 8cip:D |