NLRSRPLARKKLSEMVEEELEQMIRRREFGEGEQLPSERELMAFFNVGRPSVREALAALKRKGLVQINNGERARVSRPSA
DTIIGELSGMAKDFLSHPGGIAHFEQLRLFFESSLVRYAAEHATDEQIDLLAKALEINSQSLDNNAAFIRSDVDFHRVLA
EIPGNPIFMAIHVALLDWLIAARPTVTDQALHEHNNVSYQQHIAIVDAIRRHDPDEADRALQSHLNSV
The query sequence (length=228) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6wfq:C | 228 | 228 | 1.0000 | 1.0000 | 1.0000 | 9.91e-168 | 6on4:A, 6on4:B, 6wfq:D, 6wg7:C, 6wg7:D, 6wg7:E, 6wg7:G, 6wg7:F, 6wg7:H |
2 | 1h9t:A | 232 | 158 | 0.2105 | 0.2069 | 0.3038 | 2.41e-10 | 1h9g:A, 1h9t:B, 1hw2:A, 1hw2:B |
3 | 2di3:A | 231 | 233 | 0.2807 | 0.2771 | 0.2747 | 3.67e-07 | 2di3:B |
4 | 7c7e:A | 142 | 127 | 0.1404 | 0.2254 | 0.2520 | 3.32e-05 | |
5 | 4u0v:A | 243 | 81 | 0.1140 | 0.1070 | 0.3210 | 4.08e-05 | 4u0v:B, 4u0w:A, 4u0w:B, 4u0y:A, 4u0y:B, 4u0y:C, 4u0y:D, 4wwc:B |
6 | 7u5q:A | 217 | 228 | 0.2719 | 0.2857 | 0.2719 | 4.57e-04 | 7u5q:B |
7 | 4wwc:A | 213 | 63 | 0.1009 | 0.1080 | 0.3651 | 6.14e-04 | |
8 | 4p9u:E | 272 | 68 | 0.0965 | 0.0809 | 0.3235 | 0.001 | 4p9u:F, 4p9u:A, 4p9u:B, 4pdk:A, 4pdk:B |
9 | 5dv5:A | 267 | 61 | 0.0921 | 0.0787 | 0.3443 | 0.001 | 5dv5:B |
10 | 5d4s:B | 83 | 50 | 0.0746 | 0.2048 | 0.3400 | 0.003 | 5d4r:A, 5d4r:B, 5d4s:A, 4egy:A, 4egy:B, 4egz:A, 4egz:B, 4h0e:A, 4h0e:B |
11 | 7xp0:A | 200 | 225 | 0.2500 | 0.2850 | 0.2533 | 0.003 | 7xp1:A |
12 | 2fbh:A | 137 | 61 | 0.0833 | 0.1387 | 0.3115 | 1.2 | |
13 | 4axs:A | 291 | 53 | 0.0658 | 0.0515 | 0.2830 | 2.1 | |
14 | 3sxk:A | 140 | 100 | 0.1140 | 0.1857 | 0.2600 | 3.1 | 3sxk:B, 3sxm:A, 3sxm:B |
15 | 5xla:A | 490 | 102 | 0.1272 | 0.0592 | 0.2843 | 3.5 | 3eyk:B, 5xl3:B, 5xl3:A, 5xl4:A, 5xl4:B, 5xl6:A, 5xl7:A, 5xl7:B, 5xl9:A, 5xla:B, 5xlc:A, 5xlc:B, 5xld:A, 5xld:B |
16 | 3x3m:A | 397 | 35 | 0.0702 | 0.0403 | 0.4571 | 4.2 | 5ebc:A, 3x3n:A |
17 | 3gb5:A | 185 | 32 | 0.0614 | 0.0757 | 0.4375 | 5.0 | 3to0:A, 3to0:B |
18 | 3tnz:A | 222 | 32 | 0.0614 | 0.0631 | 0.4375 | 6.1 | 3gfd:A, 3gfd:B, 3gh8:A, 3gh8:B, 3gh8:C, 3gh8:D, 3gh8:E, 3gh8:F, 3gh8:G, 3gh8:H, 3tnz:B |
19 | 8xgm:A | 306 | 90 | 0.0921 | 0.0686 | 0.2333 | 6.5 | 8jjp:A |
20 | 8r7y:C | 312 | 96 | 0.1272 | 0.0929 | 0.3021 | 7.6 | 7bhy:A, 7bhy:B, 7bhy:C, 4oqp:A, 8r7y:D, 8r7y:A, 8r7y:B |
21 | 5b4x:B | 479 | 21 | 0.0526 | 0.0251 | 0.5714 | 8.3 | 3a7q:B, 5b4x:D, 5b4y:B |
22 | 6fbx:A | 148 | 44 | 0.0702 | 0.1081 | 0.3636 | 9.4 |