BioLiP

>protein
NLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVENPFGQPPIHGREQIAAFYRQGLKVRACLTGPVRASHNGCGAM
PFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSV

The query sequence (length=123) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7ry4:B	130	126	0.9919	0.9385	0.9683	6.97e-88	5ai1:A, 6c17:A, 6c1j:A, 6c1x:A, 3cpo:A, 1cqs:A, 1cqs:B, 1e3r:A, 1e3r:B, 1e3v:A, 1e3v:B, 3fzw:A, 3fzw:B, 5g2g:A, 5g2g:B, 1gs3:A, 2inx:A, 3ipt:A, 3ipt:B, 3ipt:C, 3ipt:D, 5kp1:A, 5kp1:B, 5kp1:C, 5kp1:D, 5kp3:A, 5kp3:B, 5kp4:B, 1ogx:A, 1ogx:B, 1oh0:A, 1oh0:B, 1oho:A, 3ows:A, 3ows:B, 3ows:C, 3ows:D, 3owu:A, 3owu:B, 3owu:C, 3owu:D, 3owy:A, 3owy:B, 3owy:C, 3owy:D, 3owy:E, 3owy:H, 2pzv:A, 2pzv:B, 2pzv:C, 2pzv:D, 7rxf:A, 7ry4:A, 3t8n:D, 3t8n:F, 6tzd:B, 6tzd:A, 6u4i:A, 6u4i:B, 6ubq:A, 6ubq:B, 6ucn:A, 6ucn:B, 6ucy:B, 6ucy:A, 6ufs:B, 3vgn:A, 3vgn:B, 1w6y:A
2	4cdl:A	126	126	0.8293	0.8095	0.8095	2.90e-70
3	1buq:A	125	122	0.3333	0.3280	0.3361	2.54e-18	1buq:B, 3m8c:B, 3m8c:D, 3m8c:C, 3myt:A, 3myt:C, 3nbr:A, 3nhx:A, 3nuv:A, 3nuv:B, 1ogz:A, 1ohp:A, 1ohp:B, 1ohp:C, 1ohp:D, 1ohs:A, 1ohs:B, 1ohs:C, 3ov4:A, 3ov4:B, 3ov4:C, 1qjg:A, 1qjg:B, 1qjg:C, 1qjg:D, 1qjg:E, 1qjg:F, 5ugi:A
4	6uad:A	121	120	0.3577	0.3636	0.3667	4.64e-18
5	6p44:B	117	121	0.3415	0.3590	0.3471	5.62e-17	6p44:A
6	6uae:C	125	120	0.3089	0.3040	0.3167	3.44e-14	6uae:A, 6uae:B, 6uae:D
7	7ytf:A	309	101	0.2439	0.0971	0.2970	3.85e-05
8	8a0h:A	324	100	0.2358	0.0895	0.2900	2.11e-04
9	6pq1:A	320	51	0.1301	0.0500	0.3137	0.002
10	5ui2:A	316	52	0.1301	0.0506	0.3077	0.003	5ui2:B
11	7zsg:1	314	44	0.0976	0.0382	0.2727	0.005	3mg1:A, 3mg1:B, 3mg2:A, 3mg2:B, 3mg3:A, 3mg3:B, 7sc9:BH, 7sc9:CQ, 7sc9:DI, 7sc9:EA, 7scb:BH, 7scc:AS, 7scc:BP, 6t6k:A, 6t6m:A, 6t6o:A, 8to2:B, 8tpj:B, 5tuw:A, 5tuw:B, 5tuw:C, 5tuw:D, 5tuw:E, 5tuw:F, 5tux:A, 5tv0:A, 4xb4:A, 4xb4:B, 4xb5:A, 7zsf:A, 7zsh:1, 7zsi:1, 7zsj:1, 7zxv:A
12	7qd1:A	311	51	0.1220	0.0482	0.2941	0.016	7qcz:A, 7qd0:A, 7qd1:C, 7qd2:A, 7qd2:C
13	8pyh:B	319	104	0.2276	0.0878	0.2692	0.017	8pyh:A
14	8pzk:A	300	101	0.1951	0.0800	0.2376	0.16
15	2z77:D	130	111	0.2114	0.2000	0.2342	1.1
16	4d11:C	436	58	0.1382	0.0390	0.2931	3.1
17	5if6:A	134	41	0.1057	0.0970	0.3171	3.9	2a15:A, 5ier:A, 5ier:B, 5ier:C, 5ier:D, 5if6:B, 5if6:C, 5if6:D, 5if6:E, 5if6:F, 2z77:A, 2z77:B, 2z77:C
18	3lop:A	353	70	0.1545	0.0538	0.2714	4.0
19	4d0t:A	496	58	0.1382	0.0343	0.2931	6.7	5ajn:A, 5ajo:A, 5ajp:A, 4d0t:C, 4d0t:F, 4d0t:B, 4d0t:D, 4d0t:E, 4d0z:B, 4d0z:E, 4d0z:A, 4d0z:C, 4d0z:D, 4d0z:F, 4d11:D, 4d11:E, 4d11:B, 4d11:A, 4d11:F, 6e7i:A, 6egs:A, 6egs:B, 2ffu:A, 2ffv:A, 2ffv:B, 5fv9:A, 5fv9:B, 5fv9:C, 5fv9:D, 5fv9:E, 5fv9:F, 5ndf:A, 5ndf:B, 5ndf:C, 5ndf:D, 5ndf:E, 5ndf:F, 6nqt:A, 6nqt:B, 6nqt:C, 6nqt:D, 6nqt:E, 6nqt:F
20	6sga:F2	915	53	0.1057	0.0142	0.2453	8.4	7pua:F2, 6sgb:F2

[Back]