BioLiP

>protein
NLNLFATILTYPAQKILKDGQKYAIISPESMRNALREMLIELGQPNNRTRLHLAVEFKEYPNPDKFADDFLFGYMVAQTN
DAKEMKKLNRPAKRDSIFRCNMAVAVNPYKYTAFQYPFALAGKDCAAKPEWVKALLQAIAELNGVAGGHARAYYEFAPRS
VVARLTPKLVAGYQTYGFDAEGNWLELSRLTATDSDNLDLPANEFWLGGELVRKMDQEQKAQLEAMGAPEKLFADLADSF
L

The query sequence (length=241) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8h67:E	299	297	1.0000	0.8060	0.8114	1.89e-166	8h67:F, 8h67:G, 8h67:H, 8h67:J, 8h67:I, 8h7q:C, 8h7q:E, 8h7q:F, 8h7q:G, 8h7q:H, 8h7q:I, 8ip0:B, 8ip0:C, 8ip0:D, 8ip0:N, 8ip0:H, 8ip0:I
2	8h7q:B	251	257	0.9668	0.9283	0.9066	7.85e-163	8h67:K, 8ip0:O
3	8fcj:H	298	229	0.2282	0.1846	0.2402	1.96e-08	8fcj:C, 8fcj:D, 8fcj:E, 8fcj:F, 8fcj:G, 8fcu:C, 8fcu:D, 8fcu:E, 8fcu:F, 8fcu:G, 8fcu:H, 8fd2:C, 8fd2:D, 8fd2:E, 8fd2:F, 8fd2:G, 8fd2:H, 8fd3:C, 8fd3:D, 8fd3:E, 8fd3:F, 8fd3:G, 8fd3:H, 8ff4:C, 8ff4:D, 8ff4:E, 8ff4:F, 8ff4:G, 8ff4:H, 8ff5:C, 8ff5:D, 8ff5:E, 8ff5:F, 8ff5:G, 8ff5:H
4	5umh:B	310	105	0.1245	0.0968	0.2857	2.7	5umh:A
5	8jze:G	217	35	0.0581	0.0645	0.4000	8.4	8jw0:G, 8jzf:G
6	2peb:A	115	31	0.0498	0.1043	0.3871	9.2	2peb:B
7	1yaa:A	412	17	0.0415	0.0243	0.5882	9.2	1yaa:B, 1yaa:C, 1yaa:D

[Back]