NLNLFATILTYPAPASNYRRSVIQKILKDGQKYAIISPESMRNALREMLIELGQPNNRTRLHSEDQLAVEFKEYPNPDKF
ADDFLFGYMVAQTNDAKEMKKLNRPAKRDSIFRCNMAVAVNPYKYDTVFYQSPLNAGDSALLHREVTHTAFQYPFALAGK
DCAAKPEWVKALLQAIAELNGVAGGHARAYYEFAPRSVVARLTPKLVAGYQTYGFDAEGNWLELSRLTATDSDNLDLPAN
EFWLGGELVRKMDQEQKAQLEAMGAHLYANPEKLFADLADSFLG
The query sequence (length=284) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8h67:E | 299 | 298 | 1.0000 | 0.9498 | 0.9530 | 0.0 | 8h67:F, 8h67:G, 8h67:H, 8h67:J, 8h67:I, 8h7q:C, 8h7q:E, 8h7q:F, 8h7q:G, 8h7q:H, 8h7q:I, 8ip0:B, 8ip0:C, 8ip0:D, 8ip0:N, 8ip0:H, 8ip0:I |
2 | 8h7q:B | 251 | 284 | 0.8803 | 0.9960 | 0.8803 | 7.67e-179 | 8h67:K, 8ip0:O |
3 | 8fcj:H | 298 | 292 | 0.2711 | 0.2584 | 0.2637 | 2.00e-14 | 8fcj:C, 8fcj:D, 8fcj:E, 8fcj:F, 8fcj:G, 8fcu:C, 8fcu:D, 8fcu:E, 8fcu:F, 8fcu:G, 8fcu:H, 8fd2:C, 8fd2:D, 8fd2:E, 8fd2:F, 8fd2:G, 8fd2:H, 8fd3:C, 8fd3:D, 8fd3:E, 8fd3:F, 8fd3:G, 8fd3:H, 8ff4:C, 8ff4:D, 8ff4:E, 8ff4:F, 8ff4:G, 8ff4:H, 8ff5:C, 8ff5:D, 8ff5:E, 8ff5:F, 8ff5:G, 8ff5:H |
4 | 8jze:G | 217 | 47 | 0.0563 | 0.0737 | 0.3404 | 0.64 | 8jw0:G, 8jzf:G |
5 | 5umh:B | 310 | 99 | 0.1056 | 0.0968 | 0.3030 | 2.4 | 5umh:A |
6 | 1mc3:A | 291 | 76 | 0.0810 | 0.0790 | 0.3026 | 3.4 | 1mc3:B |
7 | 1qzz:A | 340 | 54 | 0.0634 | 0.0529 | 0.3333 | 3.9 | 1r00:A, 1xds:A, 1xds:B, 1xdu:A |
8 | 8j9c:A | 605 | 86 | 0.0845 | 0.0397 | 0.2791 | 4.6 | 8j9c:B, 8j9c:C, 8j9c:D, 8j9d:A, 8j9d:B, 8j9d:C, 8j9d:D |
9 | 7v6g:B | 338 | 55 | 0.0669 | 0.0562 | 0.3455 | 5.1 | 6lnk:A, 6lnk:B, 7v6f:A, 7v6f:B, 7v6g:A, 7yva:A, 7yva:B |