NLHLLRQKIEEQAAKYKHSVPKKCCYDGARVNFYETCEERVARVTIGPLCIRAFNECCTIANKIRKES
The query sequence (length=68) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4wb2:C | 74 | 68 | 1.0000 | 0.9189 | 1.0000 | 5.33e-46 | 4wb2:A, 4wb3:A, 4wb3:C |
2 | 5hcc:A | 982 | 61 | 0.6029 | 0.0418 | 0.6721 | 4.11e-25 | 7ad6:A, 8ayh:A, 1cfa:A, 5hcd:A, 5hce:A |
3 | 8cem:B | 974 | 64 | 0.2941 | 0.0205 | 0.3125 | 1.06e-05 | |
4 | 2z2p:A | 293 | 38 | 0.1618 | 0.0375 | 0.2895 | 2.2 | 2z2p:B |
5 | 8ki6:A | 1580 | 44 | 0.2206 | 0.0095 | 0.3409 | 4.0 | |
6 | 8ki8:A | 1621 | 44 | 0.2206 | 0.0093 | 0.3409 | 4.1 | |
7 | 8iwh:7 | 165 | 18 | 0.1324 | 0.0545 | 0.5000 | 4.2 | 8iwh:0 |
8 | 8ki7:A | 2003 | 44 | 0.2206 | 0.0075 | 0.3409 | 4.7 | |
9 | 8w9o:A | 427 | 32 | 0.1618 | 0.0258 | 0.3438 | 9.0 | 8w9o:B |
10 | 5zn7:A | 680 | 41 | 0.1912 | 0.0191 | 0.3171 | 9.9 | 5zn7:C, 5zn7:D, 5zn7:F, 5zn7:H |