NKTIIGIDPGSGIMSLTDKAMKDYDLNDWTLISASSAAMTATLKKSYDRKKPIIITGWTPHWMFSRYKLKYLDDPKQSYG
SAEEIHTITRKGFSKEQPNAAKLLSQFKWTQDEMGEIMIKVEEGEKPAKVAAEYVNKHKDQIAEWTKGVQKVKGDKINLA
YVAWDSEIASTNVIGKVLEDLGYEVTLTQVEAGPMWTAIATGSADASLSAWLPNTHKAYAAKYKGKYDDIGTSMTGVKMG
LVVPQYMKNVNSIEDLKK
The query sequence (length=258) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5nxx:C | 265 | 258 | 1.0000 | 0.9736 | 1.0000 | 0.0 | 2b4m:A, 2b4m:B, 3chg:D, 3chg:A, 3chg:B, 3chg:C, 5nxx:D |
2 | 2reg:A | 290 | 159 | 0.1899 | 0.1690 | 0.3082 | 9.20e-19 | 2reg:B, 2rin:A, 2rin:B |
3 | 2reg:A | 290 | 68 | 0.0736 | 0.0655 | 0.2794 | 8.6 | 2reg:B, 2rin:A, 2rin:B |
4 | 1r9q:A | 309 | 124 | 0.1202 | 0.1003 | 0.2500 | 0.002 | |
5 | 7yle:A | 299 | 77 | 0.0891 | 0.0769 | 0.2987 | 0.004 | |
6 | 4xz6:A | 291 | 138 | 0.0969 | 0.0859 | 0.1812 | 0.056 | 4xz6:B |
7 | 4xz6:A | 291 | 96 | 0.0853 | 0.0756 | 0.2292 | 0.069 | 4xz6:B |
8 | 7s7x:A | 278 | 91 | 0.0969 | 0.0899 | 0.2747 | 0.061 | 7s7x:B, 7s7x:C, 6v1r:A |
9 | 7s7t:A | 509 | 91 | 0.0969 | 0.0491 | 0.2747 | 0.13 | 8i4o:A, 8i4o:C, 8i4o:E, 8i4o:G, 8i4o:I, 8i4o:K |
10 | 3zgj:B | 343 | 39 | 0.0504 | 0.0379 | 0.3333 | 0.52 | 3zgj:A |
11 | 4rxh:B | 421 | 38 | 0.0659 | 0.0404 | 0.4474 | 1.6 | 5vqi:B |
12 | 7tcl:X | 259 | 39 | 0.0581 | 0.0579 | 0.3846 | 3.7 | |
13 | 7ad3:F | 318 | 56 | 0.0736 | 0.0597 | 0.3393 | 6.8 | |
14 | 3ut0:A | 804 | 118 | 0.0930 | 0.0299 | 0.2034 | 8.0 | 3rrx:A, 3usz:A, 3ut0:B, 3ut0:C, 3ut0:D |
15 | 4zo6:B | 724 | 113 | 0.1047 | 0.0373 | 0.2389 | 9.9 | 4zo6:A, 4zo7:B, 4zo7:A, 4zo8:A, 4zo8:B, 4zo9:A, 4zo9:B, 4zoa:A, 4zoa:B, 4zob:A, 4zob:B, 4zoc:A, 4zoc:B, 4zod:A, 4zod:B, 4zoe:A, 4zoe:B |