Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
NKMRSKPSDNVAWYDKGPVEWLPRPVRLTYDHLDQLQQWTMRATLDGRTEEFNRIRDLHREWSQHPLMPVLGDVEPKFPL
NLFKQNHRAKKRFLVRWHKANTPANWLWMPRGPTVVTPLHRTNPTQYPENWKQMVQ

The query sequence (length=136) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 7aor:ax 161 136 0.9118 0.7702 0.9118 4.77e-92 6hiv:DW, 6hiw:DW, 6hiz:DW, 7pua:DW, 7pub:DW, 6sg9:DW, 6sgb:DW
2 7ane:ax 161 136 0.8088 0.6832 0.8088 6.18e-83
3 4f0l:B 449 33 0.0956 0.0290 0.3939 1.3 4f0l:A
4 1itq:A 369 55 0.1250 0.0461 0.3091 2.0 1itq:B, 1itu:A, 1itu:B
5 5hyn:A 581 60 0.1397 0.0327 0.3167 2.2 5hyn:F, 5hyn:K, 5hyn:Q, 5ls6:A, 5ls6:G, 5ls6:J, 5ls6:D
6 1nyq:B 645 62 0.1397 0.0295 0.3065 4.2 1nyq:A, 1nyr:A, 1nyr:B
7 7s7t:A 509 40 0.0956 0.0255 0.3250 5.2 8i4o:A, 8i4o:C, 8i4o:E, 8i4o:G, 8i4o:I, 8i4o:K
8 6az1:B 211 40 0.1103 0.0711 0.3750 6.0 8a3w:SB, 8a98:SB, 8ovj:SB, 8rxh:SB, 8rxx:SB, 5t2a:AC

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218