NKDPYFMKNHLGSYECKLCLTLHNNEGSYLAHTQGKKHQTNLARRAA
The query sequence (length=47) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8i0r:v | 173 | 47 | 1.0000 | 0.2717 | 1.0000 | 1.73e-30 | 7abg:F, 7abh:F, 6ff4:7, 6ff7:7, 8i0p:v, 8i0t:v, 7q4o:1, 7q4p:1, 8qo9:G, 6qx9:A2, 8qxd:8, 8r0a:8, 8r0b:8, 8rm5:8, 7vpx:B |
2 | 8ch6:I | 185 | 47 | 0.9362 | 0.2378 | 0.9362 | 7.00e-26 | 7abi:F, 7onb:M, 7qtt:I, 5z56:v, 5z57:v |
3 | 6g90:U | 196 | 44 | 0.4468 | 0.1071 | 0.4773 | 7.17e-08 | 7oqb:U, 7oqe:U |
4 | 5nrl:U | 196 | 44 | 0.4468 | 0.1071 | 0.4773 | 7.95e-08 | |
5 | 7dco:v | 207 | 44 | 0.4468 | 0.1014 | 0.4773 | 9.69e-08 | 5gm6:I, 5zwm:v, 5zwo:v |
6 | 8qzs:r | 114 | 36 | 0.2766 | 0.1140 | 0.3611 | 0.005 | 7abf:N, 7abg:N, 7abi:N, 8h6k:4N, 5o9z:N, 8q7n:r, 8qpe:r |
7 | 8idf:A | 459 | 36 | 0.2979 | 0.0305 | 0.3889 | 0.043 | |
8 | 1xed:A | 111 | 39 | 0.2553 | 0.1081 | 0.3077 | 0.40 | 1xed:B |
9 | 1zu1:A | 127 | 30 | 0.2340 | 0.0866 | 0.3667 | 0.45 | |
10 | 8ost:A | 390 | 33 | 0.2553 | 0.0308 | 0.3636 | 0.55 | |
11 | 6iw6:A | 438 | 33 | 0.2553 | 0.0274 | 0.3636 | 0.55 | 6iw6:B |
12 | 8pv1:Cb | 101 | 32 | 0.2553 | 0.1188 | 0.3750 | 0.59 | 8pv2:Cb, 8pv3:Cb, 8pv4:Cb, 8pv5:Cb, 8pv6:Cb, 8pv7:Cb, 8pv8:Cb, 8pvk:Cb, 8pvl:Cb |
13 | 6jmt:D | 350 | 36 | 0.1915 | 0.0257 | 0.2500 | 1.5 | 6jmt:C, 6jmt:E, 6jmt:F, 6jmt:A, 6jmt:B |
14 | 7mo3:B | 38 | 31 | 0.1915 | 0.2368 | 0.2903 | 2.2 | 7mo3:D, 7mo4:B, 7mo4:D |
15 | 2ebv:A | 57 | 20 | 0.1702 | 0.1404 | 0.4000 | 3.8 | |
16 | 8q7n:X | 81 | 33 | 0.2340 | 0.1358 | 0.3333 | 4.7 | 8h6k:4I, 8h6l:4I, 8qo9:X, 8qpe:X, 8qzs:X |
17 | 2crr:A | 141 | 33 | 0.1702 | 0.0567 | 0.2424 | 4.9 | |
18 | 2iqj:B | 123 | 34 | 0.1702 | 0.0650 | 0.2353 | 6.3 | 2iqj:A |
19 | 3lvq:E | 420 | 32 | 0.1915 | 0.0214 | 0.2812 | 7.0 | 2b0o:E, 2b0o:F, 2b0o:G, 2b0o:H, 3lvr:E |
20 | 8opt:A | 783 | 32 | 0.1915 | 0.0115 | 0.2812 | 7.7 | 8ops:A, 5w0m:B, 5w0n:C, 5w0o:A, 5w0o:B |
21 | 7mex:A | 1737 | 19 | 0.1702 | 0.0046 | 0.4211 | 8.8 | 6kgi:B, 7mey:A, 3nih:A, 3nii:A, 3nij:A, 3nik:B, 3nik:D, 3nik:A, 3nik:F, 3nil:D, 3nil:A, 3nil:B, 3nil:F, 3nim:B, 3nim:F, 3nim:A, 3nim:D, 3nin:A, 3nin:B, 3nis:A, 3nis:B, 3nis:D, 3nis:F, 3nit:A |