NKCGACGRTVYHAEEVQCDGRSFHRCCFLCMVCRKNLDSTTVAIHDAEVYCKSCYGKKYG
The query sequence (length=60) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1a7i:A | 60 | 60 | 1.0000 | 1.0000 | 1.0000 | 9.28e-40 | |
2 | 2o10:A | 60 | 58 | 0.7000 | 0.7000 | 0.7241 | 5.11e-28 | |
3 | 1b8t:A | 192 | 54 | 0.6667 | 0.2083 | 0.7407 | 1.05e-24 | 1ctl:A |
4 | 1b8t:A | 192 | 58 | 0.5000 | 0.1562 | 0.5172 | 4.40e-15 | 1ctl:A |
5 | 2o13:A | 58 | 58 | 0.4667 | 0.4828 | 0.4828 | 1.27e-15 | |
6 | 1cxx:A | 59 | 57 | 0.4667 | 0.4746 | 0.4912 | 1.97e-14 | 1ibi:A, 1qli:A |
7 | 2cu8:A | 76 | 61 | 0.4000 | 0.3158 | 0.3934 | 9.14e-09 | |
8 | 1iml:A | 76 | 60 | 0.4000 | 0.3158 | 0.4000 | 1.32e-07 | |
9 | 2lzu:A | 72 | 57 | 0.3333 | 0.2778 | 0.3509 | 1.84e-05 | |
10 | 8y6k:A | 741 | 51 | 0.3000 | 0.0243 | 0.3529 | 5.45e-05 | 2bra:A, 2bra:B, 2bry:A, 2bry:B, 2c4c:A, 2c4c:B, 4txi:A, 4txk:A |
11 | 2d8y:A | 91 | 57 | 0.3000 | 0.1978 | 0.3158 | 1.39e-04 | |
12 | 2ehe:A | 82 | 56 | 0.3000 | 0.2195 | 0.3214 | 2.48e-04 | |
13 | 1x4k:A | 72 | 58 | 0.2500 | 0.2083 | 0.2586 | 3.92e-04 | |
14 | 2miu:A | 98 | 61 | 0.2833 | 0.1735 | 0.2787 | 0.002 | |
15 | 2egq:A | 77 | 42 | 0.2667 | 0.2078 | 0.3810 | 0.002 | |
16 | 1wyh:A | 72 | 47 | 0.2333 | 0.1944 | 0.2979 | 0.002 | |
17 | 2co8:A | 82 | 53 | 0.3000 | 0.2195 | 0.3396 | 0.007 | |
18 | 2cuq:A | 80 | 58 | 0.2500 | 0.1875 | 0.2586 | 0.007 | |
19 | 2d8z:A | 70 | 35 | 0.2000 | 0.1714 | 0.3429 | 0.007 | |
20 | 1zfo:A | 30 | 26 | 0.1833 | 0.3667 | 0.4231 | 0.012 | |
21 | 2dlo:A | 81 | 61 | 0.2333 | 0.1728 | 0.2295 | 0.012 | |
22 | 1x61:A | 72 | 35 | 0.2167 | 0.1806 | 0.3714 | 0.078 | |
23 | 1x63:A | 82 | 59 | 0.2333 | 0.1707 | 0.2373 | 0.091 | |
24 | 2mbv:A | 96 | 36 | 0.2333 | 0.1458 | 0.3889 | 0.11 | |
25 | 6u4m:A | 65 | 40 | 0.2000 | 0.1846 | 0.3000 | 0.11 | 6u4n:B |
26 | 2xqn:T | 125 | 59 | 0.2333 | 0.1120 | 0.2373 | 0.14 | 2iyb:E, 2iyb:F, 2iyb:G, 2iyb:H |
27 | 2dfy:X | 158 | 36 | 0.2333 | 0.0886 | 0.3889 | 0.25 | 2dfy:C, 1rut:X |
28 | 2cur:A | 69 | 35 | 0.1833 | 0.1594 | 0.3143 | 0.29 | |
29 | 2cup:A | 101 | 42 | 0.2167 | 0.1287 | 0.3095 | 0.33 | |
30 | 1v6g:A | 81 | 55 | 0.2667 | 0.1975 | 0.2909 | 0.34 | |
31 | 4jcj:C | 150 | 40 | 0.2333 | 0.0933 | 0.3500 | 0.86 | 4jcj:A, 4jcj:B |
32 | 1v87:A | 114 | 39 | 0.2333 | 0.1228 | 0.3590 | 1.5 | |
33 | 2rgt:B | 154 | 63 | 0.2833 | 0.1104 | 0.2698 | 3.3 | 2rgt:A |
34 | 1x3h:A | 80 | 59 | 0.2667 | 0.2000 | 0.2712 | 3.7 | |
35 | 2jtn:A | 182 | 58 | 0.2667 | 0.0879 | 0.2759 | 4.9 | |
36 | 3mkh:A | 426 | 24 | 0.1833 | 0.0258 | 0.4583 | 5.8 | 3mkh:B, 3mkh:C, 3mkh:D |
37 | 5z2c:I | 408 | 38 | 0.2000 | 0.0294 | 0.3158 | 6.2 | |
38 | 5z2c:A | 445 | 38 | 0.2000 | 0.0270 | 0.3158 | 6.2 | 5z2c:B, 5z2c:C, 5z2c:D, 5z2c:E, 5z2c:F, 5z2c:G, 5z2c:H |
39 | 2luy:A | 96 | 57 | 0.2500 | 0.1562 | 0.2632 | 7.6 | |
40 | 6cme:A | 154 | 63 | 0.2667 | 0.1039 | 0.2540 | 8.7 | 6cme:B, 3mmk:A, 3mmk:B |
41 | 1x64:A | 89 | 30 | 0.1667 | 0.1124 | 0.3333 | 8.7 | |
42 | 7dge:A | 784 | 29 | 0.1667 | 0.0128 | 0.3448 | 9.5 | 1ewk:A, 1ewk:B, 1isr:A, 1iss:A, 1iss:B, 3ks9:A, 3ks9:B |