NITVRFVTENDKEGWQRLWKSYQDFYEVSFPDDLDDFNFGRFLDPNIKMWAAVAVESSSEKIIGMINFFNHMTTWDFKDK
IYINDLYVDENSRVKGAGGKLIQFVYDEADKLGTPSVYWCTDESNHRAQLLYVKVGYKAPKILYKRKGY
The query sequence (length=149) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1qsm:D | 152 | 149 | 1.0000 | 0.9803 | 1.0000 | 1.36e-110 | 1qsm:A, 1qsm:B, 1qsm:C |
2 | 7zkt:B | 202 | 82 | 0.1812 | 0.1337 | 0.3293 | 5.14e-06 | 7zhc:A, 7zhc:B, 7zkt:A, 7zkt:C, 7zkt:D, 7zkt:E, 7zkt:F, 7zkt:G, 7zkt:H |
3 | 7ovv:B | 196 | 75 | 0.1611 | 0.1224 | 0.3200 | 1.01e-04 | 7ovv:A |
4 | 6bvc:A | 154 | 79 | 0.1544 | 0.1494 | 0.2911 | 6.30e-04 | 1bo4:A, 1bo4:B |
5 | 2bei:A | 156 | 137 | 0.2148 | 0.2051 | 0.2336 | 0.021 | 2q4v:A |
6 | 6wqc:A | 293 | 68 | 0.1141 | 0.0580 | 0.2500 | 0.084 | 6wqb:A |
7 | 4mbu:A | 165 | 60 | 0.1208 | 0.1091 | 0.3000 | 0.16 | 4mbu:B |
8 | 2ge3:A | 164 | 45 | 0.1007 | 0.0915 | 0.3333 | 0.20 | 2ge3:B, 2ge3:C |
9 | 3pp9:A | 176 | 56 | 0.1208 | 0.1023 | 0.3214 | 0.56 | 3pp9:B, 3pp9:C |
10 | 1yvk:A | 152 | 62 | 0.1208 | 0.1184 | 0.2903 | 0.58 | 1yvk:B, 1yvk:C, 1yvk:D |
11 | 5f47:B | 152 | 101 | 0.1745 | 0.1711 | 0.2574 | 0.90 | 5f47:A, 5f48:A, 5f48:B, 5f49:A, 5f49:B, 5f49:C, 5f49:D, 5u08:A, 5u08:B, 5u08:C, 5u08:D |
12 | 2fdr:A | 222 | 46 | 0.1141 | 0.0766 | 0.3696 | 0.99 | |
13 | 3ond:B | 488 | 62 | 0.0940 | 0.0287 | 0.2258 | 2.2 | 3ond:A, 3one:A, 3one:B, 3onf:A, 3onf:B |
14 | 1b87:A | 181 | 112 | 0.1544 | 0.1271 | 0.2054 | 2.2 | 2a4n:A, 2a4n:B, 1n71:A, 1n71:B, 1n71:C, 1n71:D |
15 | 2q0y:A | 153 | 57 | 0.1074 | 0.1046 | 0.2807 | 2.9 | |
16 | 3f8k:A | 131 | 53 | 0.1141 | 0.1298 | 0.3208 | 3.8 | |
17 | 3d8p:A | 158 | 100 | 0.1477 | 0.1392 | 0.2200 | 3.9 | |
18 | 2j8m:A | 171 | 55 | 0.0872 | 0.0760 | 0.2364 | 6.7 | 2bl1:A, 2j8m:B, 2j8r:A, 2j8r:B |
19 | 5y2v:A | 304 | 43 | 0.0940 | 0.0461 | 0.3256 | 6.9 | 5y2v:B, 5y2v:C, 5y2v:D, 5y2w:A |
20 | 6qxl:J | 404 | 60 | 0.1074 | 0.0396 | 0.2667 | 7.1 | |
21 | 3gbe:A | 558 | 63 | 0.1074 | 0.0287 | 0.2540 | 7.6 | |
22 | 1wwz:A | 157 | 56 | 0.1275 | 0.1210 | 0.3393 | 7.8 | 1wwz:B |
23 | 5kf2:A | 317 | 45 | 0.1007 | 0.0473 | 0.3333 | 8.3 | 5kf1:A, 5kf1:B, 5kf8:A, 5kf9:A, 5kga:A, 5kga:B, 5kgh:A, 5kgh:B, 5kgj:A, 5kgp:A, 5kgp:B |
24 | 7mq8:LT | 869 | 74 | 0.1141 | 0.0196 | 0.2297 | 9.0 | 7mq9:LT |
25 | 7lj2:A | 507 | 32 | 0.0940 | 0.0276 | 0.4375 | 9.1 | 7lha:A, 7lha:B, 7lj2:B |