NITKNTEDILASITKEYATQTQGIFGEMIALNKSISGTLTEMFRSTSKEDLDIDNITNIITNTFDNSAYSNFTYLYLIDP
PEYFKEESKFFNTQSGKFVMLYADEEGIKAIQASDEIANLQVVQDILKKAKYGENKVYIGRPIKMNLEGQDFDAVNVAIP
IFDRKNQVVGVIGMTLDFSDIATYLLDPKGQKYDGELRVLLNSDGFMAIHPNKNLVLKNLKDINPNKGAQETYKAISEGK
NGVFNYIASDGDDSYAAINSFKVQDSSWAVLVTAPKYSVFKPLKK
The query sequence (length=285) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4wy9:A | 285 | 285 | 1.0000 | 1.0000 | 1.0000 | 0.0 | |
2 | 6fu4:A | 297 | 132 | 0.1123 | 0.1077 | 0.2424 | 0.016 | 6fu4:B, 6fu4:C, 6fu4:D |
3 | 6py3:B | 238 | 91 | 0.0842 | 0.1008 | 0.2637 | 0.021 | 6pxy:A, 6py3:A, 6py4:A, 6py5:A, 6pyi:A, 6q0f:A, 6q0g:A |
4 | 5lt9:B | 253 | 63 | 0.0702 | 0.0791 | 0.3175 | 0.12 | 5lt9:A, 5lto:A, 5lto:B |
5 | 5ltx:A | 243 | 74 | 0.0737 | 0.0864 | 0.2838 | 0.32 | 5ltx:B, 5t65:A, 5t65:B, 5t7m:A, 5t7m:B |
6 | 5ltv:D | 226 | 85 | 0.0842 | 0.1062 | 0.2824 | 0.53 | 5ltv:A, 5ltv:B, 5ltv:E |
7 | 4ac9:C | 471 | 149 | 0.1193 | 0.0722 | 0.2282 | 0.82 | 4ac9:A, 4ac9:B, 4aca:B, 4aca:C, 4acb:A, 4acb:B, 4acb:C |
8 | 4ktp:A | 767 | 60 | 0.0737 | 0.0274 | 0.3500 | 2.4 | 4ktp:B, 4ktr:A, 4ktr:D, 4ktr:E, 4ktr:F, 4ktr:G, 4ktr:H |
9 | 7nmi:B | 488 | 38 | 0.0561 | 0.0328 | 0.4211 | 3.8 | 1j55:A |
10 | 8h9d:A | 1114 | 54 | 0.0772 | 0.0197 | 0.4074 | 4.0 | |
11 | 8i54:A | 1113 | 54 | 0.0772 | 0.0198 | 0.4074 | 4.3 | |
12 | 3vb9:B | 462 | 43 | 0.0491 | 0.0303 | 0.3256 | 4.5 | 3vb9:D |
13 | 6en3:A | 934 | 47 | 0.0596 | 0.0182 | 0.3617 | 7.1 | 8a49:C, 4nuy:A, 4nuz:A |
14 | 2ero:A | 426 | 57 | 0.0596 | 0.0399 | 0.2982 | 8.0 | 2ero:B, 2erp:A, 2erp:B, 2erq:A, 2erq:B |
15 | 4tn3:B | 362 | 75 | 0.0737 | 0.0580 | 0.2800 | 8.2 | 5k3q:A, 5k3q:B, 5k3q:C, 5k3q:D, 4tn3:A, 5w9a:A, 5w9a:B |
16 | 6esq:I | 347 | 28 | 0.0316 | 0.0259 | 0.3214 | 8.7 |