NIEPVIIETRLELIGRYLDHLKKFENISLDDYLSSFEQQLITERLLQLITQAAIDINDHILSKLKSGKSYTNFEAFIELG
KYQILTPELAKQIAPSSGLANRLVHEYDDIDPNQVFMAISFALQQYPLYVRQINSYLITLEEENDLE
The query sequence (length=147) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7ae6:A | 147 | 147 | 1.0000 | 1.0000 | 1.0000 | 2.23e-104 | 7ae6:B, 7ae9:B, 7ae9:A |
2 | 7aer:B | 133 | 85 | 0.1429 | 0.1579 | 0.2471 | 4.60e-04 | 7aer:C, 7bxo:H, 6m6v:B, 6m6v:C, 6m6v:D |
3 | 6o1e:A | 431 | 69 | 0.1769 | 0.0603 | 0.3768 | 0.60 | 5ix1:B, 5ix2:A, 5ix2:B, 4qq4:A, 4qq4:B, 5svi:A, 5svi:B, 5svx:A, 5svy:A |
4 | 8pqw:A | 2892 | 88 | 0.1973 | 0.0100 | 0.3295 | 1.6 | 8pqy:A, 8pqz:A, 8pqz:J |
5 | 5nug:A | 2920 | 88 | 0.1973 | 0.0099 | 0.3295 | 1.6 | 5nug:B |
6 | 8ptk:f | 4502 | 88 | 0.1973 | 0.0064 | 0.3295 | 1.6 | 8ptk:e |
7 | 1r8d:A | 109 | 31 | 0.0884 | 0.1193 | 0.4194 | 3.1 | 1r8d:B |
8 | 3tqp:A | 418 | 61 | 0.1497 | 0.0526 | 0.3607 | 4.2 | 3tqp:B |
9 | 6gtd:A | 1269 | 50 | 0.0884 | 0.0102 | 0.2600 | 4.8 | 6i1l:D, 5nfv:A, 5ng6:A, 5ng6:C, 5ng6:E, 5ng6:G |
10 | 6gtg:A | 1298 | 50 | 0.0884 | 0.0100 | 0.2600 | 5.0 | 6gtc:A, 6gte:A, 6gtf:A, 6i1k:A, 6i1l:A |
11 | 6xtx:3 | 608 | 83 | 0.1837 | 0.0444 | 0.3253 | 8.4 | |
12 | 6wl3:F | 238 | 40 | 0.0680 | 0.0420 | 0.2500 | 8.9 | 6wl2:C, 6wl2:F, 6wl2:I, 6wl3:C, 6wl3:I, 6wl4:F, 6wl4:I |