NIEPVIIETRLELIGRYLDHLKKFENISLDDYLSSFEQQLITEELLQLITQAAIDINDHILSKLKSGKSYTNFEAFIELG
KYQILTPELAKQIAPSSGLREYDDIDPNQVFMAISFALQQYPLYVRQINSYLITLEE
The query sequence (length=137) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7ae6:A | 147 | 142 | 0.9854 | 0.9184 | 0.9507 | 2.80e-92 | 7ae6:B, 7ae9:B, 7ae9:A |
2 | 6o1e:A | 431 | 79 | 0.2190 | 0.0696 | 0.3797 | 0.097 | 5ix1:B, 5ix2:A, 5ix2:B, 4qq4:A, 4qq4:B, 5svi:A, 5svi:B, 5svx:A, 5svy:A |
3 | 7aer:B | 133 | 85 | 0.1387 | 0.1429 | 0.2235 | 0.27 | 7aer:C, 7bxo:H, 6m6v:B, 6m6v:C, 6m6v:D |
4 | 4jgt:A | 280 | 70 | 0.1168 | 0.0571 | 0.2286 | 1.6 | 4jgt:B, 4jgt:C |
5 | 5nug:A | 2920 | 88 | 0.2117 | 0.0099 | 0.3295 | 1.7 | 5nug:B |
6 | 8pqw:A | 2892 | 88 | 0.2117 | 0.0100 | 0.3295 | 1.9 | 8pqy:A, 8pqz:A, 8pqz:J |
7 | 8ptk:f | 4502 | 88 | 0.2117 | 0.0064 | 0.3295 | 1.9 | 8ptk:e |
8 | 6xtx:3 | 608 | 98 | 0.2263 | 0.0510 | 0.3163 | 2.5 | |
9 | 6mso:A | 540 | 57 | 0.1168 | 0.0296 | 0.2807 | 2.9 | 6mso:B, 6mso:C, 6mso:D |
10 | 6eri:AD | 221 | 58 | 0.1314 | 0.0814 | 0.3103 | 5.2 | 5h1s:F, 5mlc:E, 5mmi:D, 5mmm:D, 5x8p:D, 5x8t:D |