NIDDLLGDLGGTARAERAKLVEWLLEQGITPDEIRATNPPLLLATRHLVGDDGTYVSAREISENYGVDLELLQRVQRAVG
LARVDDPDAVVHMRADGEAAARAQRFVELGLNPDQVVLVVRVLAEGLSHAAEAMRYTALEAIMRPGATELDIAKGSQALV
SQIVPLLGPMIQDMLFMQLRHMM
The query sequence (length=183) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1y10:C | 363 | 183 | 1.0000 | 0.5041 | 1.0000 | 1.75e-127 | 2ev1:A, 2ev1:B, 2ev2:A, 2ev2:B, 2ev3:A, 2ev3:B, 2ev4:A, 2ev4:B, 1y10:A, 1y10:B, 1y10:D |
2 | 6vjb:A | 1346 | 72 | 0.1311 | 0.0178 | 0.3333 | 0.006 | |
3 | 5xya:A | 1358 | 72 | 0.1311 | 0.0177 | 0.3333 | 0.007 | 5xxz:A |
4 | 7edd:A | 1394 | 72 | 0.1311 | 0.0172 | 0.3333 | 0.008 | 5xyr:A |
5 | 5xxz:B | 1310 | 72 | 0.1311 | 0.0183 | 0.3333 | 0.009 | |
6 | 1ecx:B | 365 | 84 | 0.1475 | 0.0740 | 0.3214 | 2.3 | 1ecx:A, 1eg5:A, 1eg5:B |
7 | 3iv6:A | 257 | 40 | 0.0765 | 0.0545 | 0.3500 | 4.4 | 3iv6:B, 3iv6:C, 3iv6:D |
8 | 3ijh:B | 221 | 20 | 0.0601 | 0.0498 | 0.5500 | 5.6 | 3ijh:D, 3ijs:B, 3ijs:D, 3ijy:B, 3ijy:D, 3ikc:B, 3ikc:D |
9 | 3bje:A | 327 | 59 | 0.1257 | 0.0703 | 0.3898 | 6.1 | 3bje:B |
10 | 7xxf:C | 343 | 57 | 0.0820 | 0.0437 | 0.2632 | 6.4 | |
11 | 5oyn:A | 589 | 62 | 0.0929 | 0.0289 | 0.2742 | 7.0 | 5oyn:B, 5oyn:C, 5oyn:D |