NHPLLKKILMKAPGTYHHSMMVANLAEACADKIGANSLLVRVGCFYHDIGKTLRPPYFVENQLQGINPHDRLTPEQSRDI
ILSHTKDGAEILKENHMPQPIIDIALQHHGTTLLKYFYFKAKDVKEADYRYSGPKPQTKEIAIINISDSVEAAVRSSTEP
TMAKITEIIDGIIKDRFLDGQFTECDITIQEIKIIRDTLIATLNGIYH
The query sequence (length=208) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4s1b:D | 214 | 211 | 0.9952 | 0.9673 | 0.9810 | 8.65e-153 | 4s1b:A, 4s1c:D, 4s1c:A |
2 | 3tmb:B | 318 | 102 | 0.1490 | 0.0975 | 0.3039 | 0.027 | 3tm8:A, 3tm8:B, 3tmb:A, 3tmc:A, 3tmc:B, 3tmd:A |
3 | 6ky3:A | 353 | 85 | 0.1154 | 0.0680 | 0.2824 | 0.95 | |
4 | 7ux9:P | 468 | 87 | 0.1154 | 0.0513 | 0.2759 | 3.2 | |
5 | 8kcc:K | 508 | 87 | 0.1154 | 0.0472 | 0.2759 | 3.5 | 8j90:K, 8kcb:K, 8wh5:K, 8wh8:K, 8wh9:K, 8wha:K, 8wha:L |
6 | 6vij:B | 191 | 51 | 0.0769 | 0.0838 | 0.3137 | 3.6 | 6vii:B, 6vii:A, 6vij:A, 6vik:B |
7 | 7odf:A | 703 | 60 | 0.0865 | 0.0256 | 0.3000 | 4.7 | |
8 | 8f4r:B | 1033 | 19 | 0.0529 | 0.0106 | 0.5789 | 5.9 |