NGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFFASAFTKVFTLLALFSILIHAWIGMWQVLTDYVKPLALR
LMLQLVIVVALVVYVIYGFVVVWGV
The query sequence (length=105) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2acz:D | 113 | 105 | 1.0000 | 0.9292 | 1.0000 | 3.05e-69 | 7jz2:D, 7jz2:H, 7jz2:L, 1nek:D, 1nen:D, 2wdq:D, 2wdq:H, 2wdq:L, 2wdr:D, 2wdr:H, 2wdr:L, 2wdv:D, 2wdv:H, 2wdv:L, 2wp9:D, 2wp9:H, 2wp9:L, 2ws3:D, 2ws3:H, 2ws3:L, 2wu2:D, 2wu2:H, 2wu2:L, 2wu5:D, 2wu5:H, 2wu5:L, 6wu6:D, 6wu6:H, 6wu6:L |
2 | 7kv8:A | 493 | 43 | 0.1333 | 0.0284 | 0.3256 | 2.3 | 7kv8:B, 7kv8:C, 5n09:A, 5n09:B, 5n0a:A, 5n0a:B, 1oan:A, 1oan:B, 1oke:A, 1oke:B, 4ut6:A, 4ut6:B, 4uta:A, 4utb:A, 4utb:B, 4utc:A, 4utc:B |
3 | 7t3r:A | 2130 | 63 | 0.1429 | 0.0070 | 0.2381 | 2.3 | 7t3r:B, 7t3r:C, 7t3r:D, 7t3t:A, 7t3t:B, 7t3t:C, 7t3t:D |