NGTLLVPPPRTIANQDHFHRLNYLYQISAYQTRARQKARTDAHTPLARNYIKSMDLISKKTKTSLLPTIKRTICKKCHRL
LWTPKKLEITSDGALSVMCGCGTVKRFNIGADPNYRTYSEREGNLLNS
The query sequence (length=128) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6agb:K | 128 | 128 | 1.0000 | 1.0000 | 1.0000 | 2.04e-94 | 6ah3:K |
2 | 6ahr:K | 121 | 70 | 0.1719 | 0.1818 | 0.3143 | 1.74e-04 | 6ahu:K |
3 | 2ki7:B | 97 | 44 | 0.1250 | 0.1649 | 0.3636 | 0.11 | 2k3r:A |
4 | 1x0t:A | 106 | 44 | 0.1250 | 0.1509 | 0.3636 | 0.78 | 2zae:B, 2zae:D |
5 | 7wrg:A | 812 | 55 | 0.1250 | 0.0197 | 0.2909 | 3.3 |