BioLiP

>protein
NGIDCPKCKFSYALARGGCMHFHCTQCRHQFCSGCYNAFYAKNKCPEPNCRVKKSLHGHHPRDCLFYLRDWTALRLQKLL
QDNNVMFNTEPPAGGGCRVIEQKEVPNGLRDEACGKETPAGYAGLCQAHYKEYLVSLINAHSLDPATLYEVEELETATER
YLHVRPQPLAGEDPPAYQARLLQKLTEEVPLGQSIPRR

The query sequence (length=198) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6sc6:A	365	198	0.9848	0.5342	0.9848	4.76e-143	5edv:A, 5edv:B, 6gzy:A, 6gzy:B, 6kc5:B, 6kc6:A, 6kc6:C, 6kc6:E, 6kc6:G, 6kc6:I, 6kc6:K, 4ljo:A, 4ljp:A, 4ljq:B, 4ljq:C, 4ljq:A, 4ljq:D, 6sc5:A, 6sc7:A, 6sc8:A, 6sc9:A, 7v8f:B, 7v8g:D, 7v8g:C
2	7od1:A	430	32	0.0758	0.0349	0.4688	0.004	7od1:B
3	2djb:A	72	32	0.0657	0.1806	0.4062	0.74
4	3dgt:A	278	46	0.0808	0.0576	0.3478	1.2
5	7enc:0	306	53	0.0707	0.0458	0.2642	8.7	1g25:A, 8gxq:HD, 8gxs:HD, 6nmi:H, 7nvw:3, 7nvx:3, 7nvy:3, 7nvz:3, 8wak:0, 8wal:0, 8wan:0, 8wao:0, 8wap:0, 8waq:0, 8war:0, 8was:0
6	7lbm:d	275	53	0.0707	0.0509	0.2642	9.5	8byq:7
7	5c1z:A	384	33	0.0707	0.0365	0.4242	9.7	4bm9:A, 5c1z:B, 5c23:A, 5c23:B, 5c9v:A, 6glc:A, 6hue:A, 6hue:B, 4i1f:A, 4i1h:A, 8ik6:C, 8ikm:A, 8ikt:A, 8ikv:C, 8ikv:A, 8jwv:A, 5n2w:A, 5n38:A, 8wzn:A, 8wzo:A
8	5caw:C	315	33	0.0808	0.0508	0.4848	9.9	5caw:A

[Back]