NFPRTVMVNLNIHNSDYYDRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHS
PNSFRLEKILVSVGCTCVTPI
The query sequence (length=101) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5vb9:A | 108 | 101 | 1.0000 | 0.9352 | 1.0000 | 6.88e-73 | 7ama:A, 7ama:B, 7amg:A, 7amg:B, 7amg:C, 7amg:D, 8cdg:A, 8cdg:B, 8dyf:A, 8dyf:B, 8dyg:A, 8dyg:B, 8dyh:A, 8dyh:B, 8dyi:A, 8dyi:B, 5hhv:A, 5hhx:A, 5hi3:A, 5hi3:B, 5hi4:A, 5hi4:B, 5hi5:A, 5hi5:B, 8usr:A, 8usr:B, 8usr:D, 5vb9:B |
2 | 8uss:A | 107 | 108 | 0.9010 | 0.8505 | 0.8426 | 4.97e-59 | |
3 | 3jvf:B | 104 | 83 | 0.5149 | 0.5000 | 0.6265 | 5.13e-33 | |
4 | 8opp:A | 670 | 45 | 0.1287 | 0.0194 | 0.2889 | 0.33 | |
5 | 8opt:A | 783 | 45 | 0.1287 | 0.0166 | 0.2889 | 0.73 | 8ops:A, 5w0m:B, 5w0n:C, 5w0o:A, 5w0o:B |
6 | 8htu:H | 95 | 18 | 0.0891 | 0.0947 | 0.5000 | 0.77 | 7ksq:H, 7kux:H, 6l35:H, 7xqp:H |
7 | 6z1p:AR | 274 | 81 | 0.2376 | 0.0876 | 0.2963 | 2.5 | |
8 | 1ygp:A | 858 | 30 | 0.0891 | 0.0105 | 0.3000 | 2.5 | 1ygp:B |
9 | 2iag:A | 471 | 51 | 0.1287 | 0.0276 | 0.2549 | 5.3 | 3b6h:A, 3b6h:B, 2iag:B |
10 | 5by6:B | 288 | 72 | 0.1683 | 0.0590 | 0.2361 | 6.5 | 5by6:A, 5by6:C, 5by6:D, 5m4z:A, 5m4z:B |
11 | 8jjm:A | 484 | 43 | 0.1386 | 0.0289 | 0.3256 | 7.4 | 8jjm:B |
12 | 4pu5:A | 438 | 20 | 0.0891 | 0.0205 | 0.4500 | 9.7 |