NFNNSIKNVIVFYINEKALIEEKKMLSCYENKLLNLIKEDCENIMLKYKPNLSYICSLLKVDDTSEENIKHIKDQIIESL
ENNRPSVKLAIISLISMIVEMNGYKGKNIPMSFLIEDIALKISENSEDLINFINIKN
The query sequence (length=137) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6tqp:A | 142 | 138 | 1.0000 | 0.9648 | 0.9928 | 2.57e-89 | 6tqq:A, 6trr:A |
2 | 4uf2:A | 136 | 134 | 0.3504 | 0.3529 | 0.3582 | 1.90e-16 | 4uf1:A, 4uf3:A |
3 | 6xy6:C | 138 | 109 | 0.2774 | 0.2754 | 0.3486 | 7.65e-05 | 6xy4:A, 6xy6:A, 6xy6:E, 6xy6:G, 6xy6:I, 6xy6:K, 6xy6:M, 6xy6:O |
4 | 2jby:A | 127 | 97 | 0.1898 | 0.2047 | 0.2680 | 0.050 | |
5 | 7wex:A | 382 | 76 | 0.1533 | 0.0550 | 0.2763 | 0.22 | |
6 | 8ewg:A | 1017 | 65 | 0.1022 | 0.0138 | 0.2154 | 3.4 | |
7 | 6rxu:UJ | 1090 | 28 | 0.0730 | 0.0092 | 0.3571 | 5.2 | 5oql:G, 6rxt:UJ, 6rxv:UJ, 6rxy:UJ, 6rxz:UJ |